BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L15 (966 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 29 0.071 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 25 0.67 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 3.6 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 28.7 bits (61), Expect = 0.071 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 803 GGXXPPRGXXXXXXPPPPPXXPPXPPPXXPPPXXDP 910 G PP G PP P P PP PP +P Sbjct: 161 GPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMINP 196 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 25.4 bits (53), Expect = 0.67 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 894 GGXXGGGXGGXXGGGGG 844 GG GGG G G GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 897 GGGXXGGGXGGXXGGGG 847 GGG GG G GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 3.6 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 854 PPXXPPXPPPXXPPPXXDPXNRXPP 928 PP PP PP P R PP Sbjct: 61 PPHHYGGPPSGGQPPQGMPYPRFPP 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,346 Number of Sequences: 336 Number of extensions: 2253 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27306312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -