BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L11 (971 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccha... 26 9.2 >SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.8 bits (54), Expect = 9.2 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = +2 Query: 434 RIRGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLXEHHKNRRSSQRWRNPT 595 R+ E T + S G+ PR RF++G+ + N +Q + N T Sbjct: 511 RVTSRMSEHTGNRVVSFPRGSAFNPRVTRFNVGNEQFSNNIDNNNYNQPYANAT 564 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,144,450 Number of Sequences: 5004 Number of extensions: 54900 Number of successful extensions: 113 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 499296500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -