BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L11 (971 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80215-14|CAI79138.1| 662|Caenorhabditis elegans Hypothetical p... 29 3.8 Z80215-13|CAI79137.1| 640|Caenorhabditis elegans Hypothetical p... 29 3.8 Z80215-12|CAB02277.1| 652|Caenorhabditis elegans Hypothetical p... 29 3.8 U23528-7|AAK31383.2| 254|Caenorhabditis elegans Hypothetical pr... 29 3.8 AC006729-6|AAF60464.1| 282|Caenorhabditis elegans Hypothetical ... 28 8.7 >Z80215-14|CAI79138.1| 662|Caenorhabditis elegans Hypothetical protein C36B1.12c protein. Length = 662 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 522 KRQQRGLFTVPGLLLAFCSHVLSCV-IPLILWITVL 418 +RQ + + +A C HVL C+ +P + WI++L Sbjct: 390 RRQPYAFILLDVINMALCMHVLKCLRLPSLKWISIL 425 >Z80215-13|CAI79137.1| 640|Caenorhabditis elegans Hypothetical protein C36B1.12b protein. Length = 640 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 522 KRQQRGLFTVPGLLLAFCSHVLSCV-IPLILWITVL 418 +RQ + + +A C HVL C+ +P + WI++L Sbjct: 390 RRQPYAFILLDVINMALCMHVLKCLRLPSLKWISIL 425 >Z80215-12|CAB02277.1| 652|Caenorhabditis elegans Hypothetical protein C36B1.12a protein. Length = 652 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 522 KRQQRGLFTVPGLLLAFCSHVLSCV-IPLILWITVL 418 +RQ + + +A C HVL C+ +P + WI++L Sbjct: 390 RRQPYAFILLDVINMALCMHVLKCLRLPSLKWISIL 425 >U23528-7|AAK31383.2| 254|Caenorhabditis elegans Hypothetical protein B0034.1 protein. Length = 254 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = -3 Query: 813 PXPXFGSGXTXPPXL----RXXNSXGVXYEKAPRFPKGERRTGIPGK 685 P P F G T PP L R + G + P FP+GE+ + G+ Sbjct: 139 PSPPFSLGVTRPPTLIGTERSESENGGRHRPRPWFPEGEQIPEVTGE 185 >AC006729-6|AAF60464.1| 282|Caenorhabditis elegans Hypothetical protein Y24D9A.5 protein. Length = 282 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 413 GGNTVIHRIRGITQERTCEQKASKRPGTVK 502 GG +V +R + Q+++ ++SKRPG ++ Sbjct: 167 GGKSVFYRFTNLIQKKSFSVRSSKRPGILQ 196 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,059,828 Number of Sequences: 27780 Number of extensions: 340753 Number of successful extensions: 786 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2521399358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -