BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L10 (974 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 25 1.2 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 2.7 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +1 Query: 751 GGGXPPXXXXKXSXVXPPRXPPXSXPPXFXPPPXN 855 G PP + + P+ PP PP F P N Sbjct: 161 GPALPPAGFLCNNYLPLPQVPPLPLPPIFAPTMIN 195 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 2.7 Identities = 11/35 (31%), Positives = 13/35 (37%) Frame = +1 Query: 751 GGGXPPXXXXKXSXVXPPRXPPXSXPPXFXPPPXN 855 G PP + P+ PP PP F P N Sbjct: 161 GPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMIN 195 Score = 22.2 bits (45), Expect = 6.3 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 735 PPXXXRGGXPPPXGXKXXPGXPPPXPPXLXPPXVXPP 845 P G PP G P P P L P + PP Sbjct: 155 PSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPP 191 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,449 Number of Sequences: 336 Number of extensions: 2868 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27616611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -