BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_L09 (1062 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24495| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.6 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 29 8.4 >SB_24495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 199 YFRSRIRWWCKSKNCSSVDVAFTSXPVRKCYFCSKYRG 312 +FR + K + + FT+ + KC+ CS YRG Sbjct: 134 WFRRALTSGMKESIDKKISIPFTNPALFKCFLCSLYRG 171 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 337 NPX*REIRGRGT*SRSNTSVQA*K*RQHP 251 NP +E RGR T +R NTSV K Q P Sbjct: 455 NPRKKEPRGRNTSNRVNTSVSGRKHEQRP 483 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,271,793 Number of Sequences: 59808 Number of extensions: 245641 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3201496110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -