BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K24 (868 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 7.2 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 22 7.2 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 22 7.2 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 7.2 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 232 REKVESALAPXDC*EKLWHDGRQLQRIL*KSEARGSTESLRSNFLVSKYITPNISNVI 405 R ++ SAL + K+W R++++ E E + ++ S +P+ +N+I Sbjct: 283 RIEIASALQLNETQVKIWFQNRRMKQKKRMKEGLIPPEPISASLSTSNSNSPSSTNLI 340 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.8 bits (44), Expect = 7.2 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 232 REKVESALAPXDC*EKLWHDGRQLQRIL*KSEARGSTESLRSNFLVSKYITPNISNVI 405 R ++ SAL + K+W R++++ E E + ++ S +P+ +N+I Sbjct: 72 RIEIASALQLNETQVKIWFQNRRMKQKKRMKEGLIPPEPISASLSTSNSNSPSSTNLI 129 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.8 bits (44), Expect = 7.2 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 232 REKVESALAPXDC*EKLWHDGRQLQRIL*KSEARGSTESLRSNFLVSKYITPNISNVI 405 R ++ SAL + K+W R++++ E E + ++ S +P+ +N+I Sbjct: 72 RIEIASALQLNETQVKIWFQNRRMKQKKRMKEGLIPPEPISASLSTSNSNSPSSTNLI 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,230 Number of Sequences: 336 Number of extensions: 2413 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23893023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -