BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K21 (899 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po... 31 0.17 >SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 937 Score = 31.5 bits (68), Expect = 0.17 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 596 QDYKDTRRFPLEAP-SCALLFRPCRLRIPVRLSPFGKRGAFS*LTHAXRYLSSGVXSFAP 772 Q+ K+ R +E+P +L+++ CRLR+P + FG G YL+S + S P Sbjct: 612 QEAKEAVRDIIESPVKYSLIYKQCRLRLPTGILLFGYPGC------GKTYLASAISSTFP 665 Query: 773 SWAVCPKPPVQPDR 814 + K P D+ Sbjct: 666 VQFISIKGPELLDK 679 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,221,919 Number of Sequences: 5004 Number of extensions: 60798 Number of successful extensions: 154 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 454497130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -