BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K20 (898 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 36 0.034 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.10 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_17493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.31 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.6 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.7 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.2 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 30 2.2 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 30 2.9 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 3.9 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 3.9 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 29 3.9 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 29 3.9 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 29 3.9 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 5.1 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 5.1 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 6.7 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 28 8.9 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 215 GGRXPPXXKXPXGXXP-PPPXXGGXXPQMXKTP-XKXXPXKTPXGKKXGXXGKGGPP 379 GG PP P G P PPP GG P P P P G G G PP Sbjct: 916 GGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPP 972 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +2 Query: 191 APXXXPLWGGRXPPXXKXPXGXXPPPPXXGGXXPQMXKTPXKXXPXKTP 337 AP P GG PP P G PPP GG P + P P P Sbjct: 941 APSQPPPPGGNAPPPPPPPGGSAPPP---GGGAPPLPPPPGGSAPPPPP 986 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXP 630 PPPP G P GGAPP PP G P P Sbjct: 955 PPPPPGGSAPPPGGGAPP---LPPPPGGSAPPP 984 Score = 31.5 bits (68), Expect = 0.96 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 5/75 (6%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGG--XXXPPVXGG---XPXPKXGGVKXXXXXXXXXXXXXXXX 696 PPPPGG P PPGG PP GG P P GG Sbjct: 923 PPPPGGNAPLPP---PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Query: 697 XXXXXXXXPXXPPPP 741 P PPPP Sbjct: 980 SAPPPPPPPPPPPPP 994 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPPKXAPXXXXXXXXXXXXXXXXXXXXXGPXPPP 835 AP + PPGG P PPPP + P PPP Sbjct: 941 APSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPPKXAP 754 AP PPGG P PPPP P Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPP 992 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPP 742 AP PPGG P PPPP Sbjct: 930 APLPPPPPGGSAPSQPPPP 948 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 215 GGRXPPXXKXPXGX-XPPPPXXGGXXPQMXKTPXKXXPXKTP 337 GG P P G PPPP GG P P P + P Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPP 946 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 191 APXXXPLWGGRXPPXXKXPXGX-XPPPPXXGGXXP 292 AP P GG P P G PPPP GG P Sbjct: 930 APLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPP 742 P PPGG P PPPP Sbjct: 920 PPPPPPPGGNAPLPPPPP 937 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXG 639 PP PGG P GG PP G P GG P P+ G Sbjct: 31 PPAPGGY--PPAPGGYPPSGGYGYPPAGGYPPPQPG 64 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXGG 642 P PGG P GG PP PP GG P GG Sbjct: 24 PAAPGGY--PPAPGGYPPAPGGYPP-SGGYGYPPAGG 57 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 532 PPPPGGX*GXPXXG-GAPPGGXXXPPVXG--GXPXP 630 PP PGG P G G PP G PP G G P P Sbjct: 38 PPAPGGY--PPSGGYGYPPAGGYPPPQPGYAGGPPP 71 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPPKXAP 754 AP PPGG PP PPPP P Sbjct: 303 APPPPPPPGGAPPPPPPPPPPPP 325 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXGG 642 PPPP PPGG PP P P GG Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGG 329 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 294 WGXXPPXLG-GGGXXPXGXFXXGGSRPPHKGXXXG 193 WG PP G GGG P G GG PP G G Sbjct: 490 WGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 524 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 294 WGXXPPXLG-GGGXXPXGXFXXGGSRPPHKGXXXG 193 WG PP G GGG P G GG PP G G Sbjct: 523 WGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 557 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXG---GXPXPKXG 639 PPPPG P GA GG PP G G P P G Sbjct: 579 PPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPPGSG 617 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXG---GXPXPKXG 639 PPP G G P GA GG PP G G P P G Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 531 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXG---GXPXPKXG 639 PPP G G P GA GG PP G G P P G Sbjct: 526 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 564 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 294 WGXXPPXLGGGGXXPXGXFXXGGSRPPHKG 205 WG PP G GG P GG PP G Sbjct: 556 WGQPPPGAGQGGGPPPPGAGQGGPPPPGAG 585 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPV-XGGXPXPKXGG 642 PPPPG G P GA G P GG P P G Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAG 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 532 PPPPG-GX*GXPXXGGAPPGGXXXPP--VXGGXPXPKXGG 642 PPPPG G G P GA G PP GG P P G Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 542 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 532 PPPPG-GX*GXPXXGGAPPGGXXXPP--VXGGXPXPKXGG 642 PPPPG G G P GA G PP GG P P G Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 575 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 532 PPPPGG--X*GXPXXGGAPPGGXXXPPVXGGXPXPKXGG 642 PPPPG G P G GG P G P P G Sbjct: 547 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAG 585 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXGG 642 PPP G G P GA GG P P P G Sbjct: 559 PPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAG 595 >SB_17493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 718 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 538 PPGGX*GXPXXGGAPPGGXXXPPVXGGXP 624 PPG G P GG PPG PP G P Sbjct: 302 PPGMEEGPPGTGGGPPGSVGAPPGMGDGP 330 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 541 PGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXG 639 P G G P G PPG PP GG P G Sbjct: 290 PSGI-GSPSIGSGPPGMEEGPPGTGGGPPGSVG 321 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 538 PPGGX*GXPXXGGAPPGGXXXPPVXG 615 PPG G P GAPPG PP G Sbjct: 309 PPGTGGGPPGSVGAPPGMGDGPPGTG 334 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXP 630 PPPP P GGA P PPV G P P Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 206 PLWGGRXPPXXKXPXGX-XPPPPXXGGXXPQMXKTPXKXXP 325 P+ G PP P G PPPP G P P P Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPP 742 AP PP PP PPPP Sbjct: 101 APPPPPPPPPPPPPPPPPP 119 Score = 22.6 bits (46), Expect(2) = 1.6 Identities = 11/38 (28%), Positives = 11/38 (28%) Frame = +2 Query: 722 PXXPPPPKXAPXXXXXXXXXXXXXXXXXXXXXGPXPPP 835 P PPPP AP GP P P Sbjct: 138 PPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAP 175 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 206 PLWGGRXPPXXKXPXGXXPPPPXXGGXXPQMXKTP 310 P +GG PP PPPP GG P K P Sbjct: 647 PFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 535 PPPG-GX*GXPXXGGAPPGGXXXPPVXGGXP 624 PPPG G P GG PP G P GG P Sbjct: 259 PPPGFPPMGMPGMGGMPPPGMPPPMPPGGMP 289 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXGGVK 648 PPPP G G PP G PP G P + VK Sbjct: 200 PPPPPGFPGGAPPPPPPPFGAPPPPALNGGPPREYCDVK 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXP 624 PPPP G P GGAP G P G P Sbjct: 264 PPPPAYGGGPPAYGGAPNYGGAPPMGYGAQP 294 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 194 PXXXPLWGGRXPPXXKXPXGXXPPPPXXG 280 P PL GG PP G PPPP G Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 194 PXXXPLWG----GRXPPXXKXPXGXXPPPPXXGGXXP 292 P +WG G PP P G PPPP G P Sbjct: 201 PGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDP 237 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 535 PPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXP 630 PPP G G P GG PPGG PP G P Sbjct: 209 PPPMG--GPPPMGG-PPGGYPPPPPPPGAGDP 237 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPPKXAP 754 P PPGG PP PPP P Sbjct: 216 PPMGGPPGGYPPPPPPPGAGDP 237 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +1 Query: 535 PPPGGX*GXPXXGG----APPGGXXXPPVXGGXP 624 PPPGG G P GG PPGG P P Sbjct: 237 PPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 535 PPPGGX*GXPXXGG--APPGGXXXPPVXGGXPXP 630 PPPG GG PPGG PP G P P Sbjct: 175 PPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPP 208 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 532 PPPPG----GX*GXPXXGGAPPGGXXXPPVXGGXPXPKXG 639 PPPPG G G P PPG P GG P G Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGG 195 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPPKXAPXXXXXXXXXXXXXXXXXXXXXGPXPPP 835 P PP PP PPPP P P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPPKXAPXXXXXXXXXXXXXXXXXXXXXGPXPPP 835 P PP PP PPPP +P P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPPKXAPXXXXXXXXXXXXXXXXXXXXXGPXPPP 835 +P PP PP PPPP P P PPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPPKXAP 754 P PP PP PPPP AP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAP 420 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 704 PPGGXPPXXPPPPKXAP 754 PP G PP PPPP P Sbjct: 190 PPSGGPPPPPPPPPPPP 206 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 704 PPGGXPPXXPPPPKXAP 754 P GG PP PPPP P Sbjct: 191 PSGGPPPPPPPPPPPPP 207 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAP-PGGXXXPPVXGGXPXPKXGGV 645 PP P G G P G P P G PP G P GGV Sbjct: 633 PPSPPGPPGPPGPKGPPGPNGPLGPPGESG-PAGNAGGV 670 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAP-PGGXXXPPVXGGXPXPKXGGV 645 PP P G G P G P P G PP G P GGV Sbjct: 718 PPSPPGPPGPPGPNGPPGPNGPLGPPGECG-PAGNAGGV 755 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXGG 642 PPPP P GG PP PP+ GG P P G Sbjct: 195 PPPP-----PPGPGGIPP---PPPPIRGGVPPPPPMG 223 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 191 APXXXPLWGGRXPPXXKXPXGXXPPPPXXGGXXP 292 +P W PP P G PPPP G P Sbjct: 184 SPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVP 217 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 194 PXXXPLWGGRXPPXXKXPXGXXPPPPXXGG 283 P P GG PP G PPPP GG Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPP 742 P PP G PP PPPP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXP 630 PPP G P GG P PP+ G P P Sbjct: 283 PPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAP 315 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 683 RAPXKXXPPGGXP-PXXPPPPKXAP 754 R P + PPG P P PPPP AP Sbjct: 311 RPPTRIPPPGMGPPPRIPPPPIRAP 335 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 532 PPPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXP 630 PPPP P APP PP P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 683 RAPXKXXPPGGXPPXXPPPPKXAP 754 +AP PP PP PPPP P Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPP 485 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 535 PPPGGX*GXPXXGGAPPGGXXXPPVXGGXPXPKXGGVK 648 PPPGG G PP G PP P P GG++ Sbjct: 223 PPPGGM----PPGRMPPQGLPFPPPGPIPPPPGAGGMR 256 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 704 PPGGXPPXXPPPPKXAP 754 PP G PP PPPP P Sbjct: 193 PPFGGPPSAPPPPPAPP 209 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 686 APXKXXPPGGXPPXXPPPP 742 AP PP PP PPPP Sbjct: 230 APAPPPPPAAAPPPPPPPP 248 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 532 PPPPGGX*GXPXXG-GAPPGGXXXPPVXGGXPXP 630 PPPPGG G P G P PP G P P Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 689 PXKXXPPGGXPPXXPPPPKXAP 754 P PP PP PPPP +P Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSP 237 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,895,188 Number of Sequences: 59808 Number of extensions: 168171 Number of successful extensions: 1429 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2574115416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -