BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K17 (896 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038660-1|AAC39733.1| 373|Homo sapiens beta-1,4-galactosyltran... 31 4.3 AK092711-1|BAC03955.1| 149|Homo sapiens protein ( Homo sapiens ... 31 5.7 >AF038660-1|AAC39733.1| 373|Homo sapiens beta-1,4-galactosyltransferase protein. Length = 373 Score = 31.5 bits (68), Expect = 4.3 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 554 ASQKSTLKSEVAKPDRTIKIPGVSPWKLPRALSSLLXPTLXVXPDTCPP 700 A+ S+ S ++P+ T G+ ++P AL PTL PDT PP Sbjct: 57 AASSSSSSSNCSRPNATASSSGLP--EVPSALPGPTAPTLPPCPDTSPP 103 >AK092711-1|BAC03955.1| 149|Homo sapiens protein ( Homo sapiens cDNA FLJ35392 fis, clone SKNSH2000716. ). Length = 149 Score = 31.1 bits (67), Expect = 5.7 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 552 RQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPPDSV 436 RQ G G A R F S P GLL CS LR PDSV Sbjct: 69 RQHFGIPGYPEAARDFSSS-PAPGLLTLCSRLRAKPDSV 106 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,562,598 Number of Sequences: 237096 Number of extensions: 2296898 Number of successful extensions: 9894 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9892 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11548247776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -