BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K12 (894 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC18E5.06 |rps21||40S ribosomal protein S21|Schizosaccharomyce... 51 2e-07 >SPBC18E5.06 |rps21||40S ribosomal protein S21|Schizosaccharomyces pombe|chr 2|||Manual Length = 87 Score = 51.2 bits (117), Expect = 2e-07 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +2 Query: 164 MQXXAGXFVDLYCPRKCSASNRLIHAKDHAS 256 M+ AG VDLY PRKCSA+NR+I AKDHAS Sbjct: 1 MENEAGQLVDLYVPRKCSATNRIIQAKDHAS 31 Score = 41.9 bits (94), Expect = 1e-04 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 261 QLVIADVDPATGRAADTSKM-YVVCGAIRRMGESDDCIVRLTKKDGIL 401 Q+ + VD A GR K Y + G +R GESDDCI RLT +DG+L Sbjct: 33 QINVCAVD-AEGRQIPGEKTTYAISGFVRSKGESDDCINRLTTQDGLL 79 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,067,853 Number of Sequences: 5004 Number of extensions: 28164 Number of successful extensions: 45 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -