BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K12 (894 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0976 + 12841257-12841306,12841396-12841528,12842126-12842191 50 3e-06 03_05_0610 - 26108546-26108671,26108739-26108789,26109410-261095... 48 1e-05 >03_02_0976 + 12841257-12841306,12841396-12841528,12842126-12842191 Length = 82 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 164 MQXXAGXFVDLYCPRKCSASNRLIHAKDHAS 256 MQ G VDLY PRKCSA+NR+I AKDHAS Sbjct: 1 MQNEEGQMVDLYVPRKCSATNRIITAKDHAS 31 >03_05_0610 - 26108546-26108671,26108739-26108789,26109410-26109542, 26109633-26109682 Length = 119 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 164 MQXXAGXFVDLYCPRKCSASNRLIHAKDHAS 256 MQ G VDLY PRKCS +NR+I AKDHAS Sbjct: 1 MQNEEGQMVDLYVPRKCSTTNRIITAKDHAS 31 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,022,494 Number of Sequences: 37544 Number of extensions: 218689 Number of successful extensions: 458 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -