BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K12 (894 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00033-12|AAC48297.2| 88|Caenorhabditis elegans Ribosomal prot... 61 1e-09 >U00033-12|AAC48297.2| 88|Caenorhabditis elegans Ribosomal protein, small subunitprotein 21 protein. Length = 88 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +3 Query: 261 QLVIADVDPATGRAAD-TSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKN 410 Q+ DVDP TGR S Y +CGAIRRMGESDD I+RL +KDG++ ++ Sbjct: 33 QIDFVDVDPETGRMIPGKSTRYAICGAIRRMGESDDAILRLAQKDGLVPRD 83 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 164 MQXXAGXFVDLYCPRKCSASNRLIHAKDHAS 256 MQ AG V+LY PRKCS+SNR+I KDHAS Sbjct: 1 MQNDAGQTVELYVPRKCSSSNRIIGPKDHAS 31 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,328,002 Number of Sequences: 27780 Number of extensions: 184937 Number of successful extensions: 324 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2265843888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -