BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K12 (894 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribo... 46 4e-05 At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribo... 46 4e-05 >At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribosomal protein S21, Zea mays, PIR:T03945 Length = 85 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 164 MQXXAGXFVDLYCPRKCSASNRLIHAKDHAS 256 MQ G +LY PRKCSA+NRLI +KDHAS Sbjct: 1 MQNEEGQVTELYIPRKCSATNRLITSKDHAS 31 >At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribosomal protein S21, cytosolic - Oryza sativa, PIR:S38357 Length = 82 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +2 Query: 164 MQXXAGXFVDLYCPRKCSASNRLIHAKDHAS 256 M+ AG +LY PRKCSA+NR+I +KDHAS Sbjct: 1 MENDAGQVTELYIPRKCSATNRMITSKDHAS 31 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,413,042 Number of Sequences: 28952 Number of extensions: 162153 Number of successful extensions: 249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -