BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K11 (922 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79780.1 68414.m09310 integral membrane protein, putative con... 29 3.3 At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein... 29 4.3 At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein... 29 4.3 At5g51630.2 68418.m06402 disease resistance protein (TIR-NBS-LRR... 29 4.3 At5g51630.1 68418.m06401 disease resistance protein (TIR-NBS-LRR... 29 4.3 At2g47260.1 68415.m05901 WRKY family transcription factor contai... 29 4.3 At1g70410.3 68414.m08100 carbonic anhydrase, putative / carbonat... 29 4.3 At1g70410.2 68414.m08101 carbonic anhydrase, putative / carbonat... 29 4.3 At1g70410.1 68414.m08099 carbonic anhydrase, putative / carbonat... 29 4.3 At4g08450.1 68417.m01393 disease resistance protein (TIR-NBS-LRR... 28 7.6 At3g30610.1 68416.m03875 hypothetical protein 28 7.6 At2g17060.1 68415.m01970 disease resistance protein (TIR-NBS-LRR... 28 7.6 >At1g79780.1 68414.m09310 integral membrane protein, putative contains 1 transmembrane domain; contains plant integral membrane protein domain, TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588); similar to putative ethylene responsive element binding protein (GI:22135858) [Arabidopsis thaliana] Length = 168 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 867 FCNHYIFSMILTSLTMXFFSSERFF 793 FCNH S++L L+ F +S FF Sbjct: 136 FCNHVALSLLLVFLSFIFLASSSFF 160 >At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein (ZWICHEL) identical to kinesin-like protein GI:2224925 from [Arabidopsis thaliana] Length = 1260 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +3 Query: 378 KNLFNLLKDAEEQYSFS-KSNKVTTTQD--YGTIDRKSYRKLKHEMKQ 512 K LFN+LK +++SFS K+ V QD + KS R+LK E+K+ Sbjct: 994 KELFNILKRDSKRFSFSLKAYMVELYQDTLVDLLLPKSARRLKLEIKK 1041 >At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein (ZWICHEL) identical to kinesin-like protein GI:2224925 from [Arabidopsis thaliana] Length = 1259 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +3 Query: 378 KNLFNLLKDAEEQYSFS-KSNKVTTTQD--YGTIDRKSYRKLKHEMKQ 512 K LFN+LK +++SFS K+ V QD + KS R+LK E+K+ Sbjct: 993 KELFNILKRDSKRFSFSLKAYMVELYQDTLVDLLLPKSARRLKLEIKK 1040 >At5g51630.2 68418.m06402 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1175 Score = 29.1 bits (62), Expect = 4.3 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = +3 Query: 381 NLFNL-LKDAEEQYSFSKSNKVTTTQDYGTIDRKSYRKLKHEMKQFRGKQSIFKRPEANI 557 NL N+ L +E+ F +KVT T+D + L QS+ K E N+ Sbjct: 721 NLVNIDLSLSEKLKEFPNLSKVTNLD---TLDLYGCKSLVTVPSSI---QSLSKLTELNM 774 Query: 558 RECLETKAVPDHVKNPEKWKYYSLSGC 638 R C +A+P V N E LSGC Sbjct: 775 RRCTGLEALPTDV-NLESLHTLDLSGC 800 >At5g51630.1 68418.m06401 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1229 Score = 29.1 bits (62), Expect = 4.3 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = +3 Query: 381 NLFNL-LKDAEEQYSFSKSNKVTTTQDYGTIDRKSYRKLKHEMKQFRGKQSIFKRPEANI 557 NL N+ L +E+ F +KVT T+D + L QS+ K E N+ Sbjct: 785 NLVNIDLSLSEKLKEFPNLSKVTNLD---TLDLYGCKSLVTVPSSI---QSLSKLTELNM 838 Query: 558 RECLETKAVPDHVKNPEKWKYYSLSGC 638 R C +A+P V N E LSGC Sbjct: 839 RRCTGLEALPTDV-NLESLHTLDLSGC 864 >At2g47260.1 68415.m05901 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 337 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +3 Query: 450 TQDYGTIDRKSYRKLKHEMKQFRGKQSIFKRPEANIRECLETKAVPDHVKNPEKWKYYSL 629 T+D + ++ H KQ + K++ KR + R TK+ DH+++ +W+ Y Sbjct: 126 TEDNEEEGGEDQQEKSHTKKQLKAKKNNQKR-QREARVAFMTKSEVDHLEDGYRWRKYGQ 184 Query: 630 SGCYN 644 N Sbjct: 185 KAVKN 189 >At1g70410.3 68414.m08100 carbonic anhydrase, putative / carbonate dehydratase, putative similar to SP|P42737 Carbonic anhydrase 2 (EC 4.2.1.1) (Carbonate dehydratase 2) {Arabidopsis thaliana}; contains Pfam profile PF00484: Carbonic anhydrase Length = 258 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 400 KTLKNSTVFRNLIKSQQPKIM 462 K LKNST+F +L K+Q PK + Sbjct: 63 KYLKNSTLFNHLAKTQTPKFL 83 >At1g70410.2 68414.m08101 carbonic anhydrase, putative / carbonate dehydratase, putative similar to SP|P42737 Carbonic anhydrase 2 (EC 4.2.1.1) (Carbonate dehydratase 2) {Arabidopsis thaliana}; contains Pfam profile PF00484: Carbonic anhydrase Length = 280 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 400 KTLKNSTVFRNLIKSQQPKIM 462 K LKNST+F +L K+Q PK + Sbjct: 85 KYLKNSTLFNHLAKTQTPKFL 105 >At1g70410.1 68414.m08099 carbonic anhydrase, putative / carbonate dehydratase, putative similar to SP|P42737 Carbonic anhydrase 2 (EC 4.2.1.1) (Carbonate dehydratase 2) {Arabidopsis thaliana}; contains Pfam profile PF00484: Carbonic anhydrase Length = 258 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 400 KTLKNSTVFRNLIKSQQPKIM 462 K LKNST+F +L K+Q PK + Sbjct: 63 KYLKNSTLFNHLAKTQTPKFL 83 >At4g08450.1 68417.m01393 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1234 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 564 CLETKAVPDHVKNPEKWKYYSLSGCYN 644 CL VP + N K Y ++SGC+N Sbjct: 665 CLSLVEVPSTIGNLNKLTYLNMSGCHN 691 >At3g30610.1 68416.m03875 hypothetical protein Length = 112 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/46 (32%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +1 Query: 631 RDVTTEQMSDATNTATALAFIKELEEKH-EDHRTEQEKLDDDIFKK 765 R + TE++S A++ ++ FIKE EE H D + +++ + ++ KK Sbjct: 19 RLLETEKISKASSLSSDATFIKETEEAHFLDLKLREKETELNLLKK 64 >At2g17060.1 68415.m01970 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1195 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 552 NIRECLETKAVPDHVKNPEKWKYYSLSGC 638 N+ C+E K +P ++ E Y +L GC Sbjct: 710 NLEGCIELKTLPQEMQEMESLIYLNLGGC 738 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,082,405 Number of Sequences: 28952 Number of extensions: 295043 Number of successful extensions: 910 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2188225800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -