BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K07 (961 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 29 0.97 SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 27 5.2 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 29.1 bits (62), Expect = 0.97 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 4/72 (5%) Frame = +2 Query: 485 SKRPGTVKRPRCWRF--SIGS--APLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCAL 652 S+ P T+ RP +R S+G+ +PL S +++D E+ D +T +P+ A Sbjct: 316 SRTPNTLNRPSNYRSHSSMGTRRSPLNSPSQLDPISNENESDTDDSNTGLRNRTSPTAAP 375 Query: 653 PVPTLPLTGYLS 688 P P+ TG L+ Sbjct: 376 PPPSRRKTGGLN 387 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 26.6 bits (56), Expect = 5.2 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 548 LTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALPVPTLPLT 676 + ++++ + GGE + DT PLE ALP+ PLT Sbjct: 174 IDQLSRLVEILEGGEISSEILDTL-LPLEIEDLALPLSLYPLT 215 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,669,828 Number of Sequences: 5004 Number of extensions: 49928 Number of successful extensions: 136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 491307756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -