BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K06 (877 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 131 8e-33 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 3.1 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 7.3 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 9.6 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 131 bits (316), Expect = 8e-33 Identities = 63/157 (40%), Positives = 97/157 (61%), Gaps = 2/157 (1%) Frame = +3 Query: 162 VIHWFRLDLRIHDNLALRNAINEAENRKHLLRPIYFLDPNI--KDKVGINRLRFLLQSLE 335 ++HWFR LR+HDN +LR + A R ++ LDP VGIN+ RFLLQ LE Sbjct: 19 MVHWFRRGLRLHDNPSLREGLKGART----FRCVFVLDPWFAGSSNVGINKWRFLLQCLE 74 Query: 336 DLDSNLKKLNTCLYVLRGKAVDLLPKLFDDWQVKYLTCQVDIDPEFVQQDEYIEDIAEKK 515 DLD +L+KLN+ L+V+RG+ D LPKLF +W LT + D +P +D + + ++ Sbjct: 75 DLDRSLRKLNSRLFVIRGQPADALPKLFKEWGTTALTFEEDPEPFGGVRDHNLTTLCQEL 134 Query: 516 GVFINKRVQHTVYDVHKVLRENNGAVPLTYQKFLSLV 626 G+ + ++V HT+Y + ++ N G PLTY +FL+++ Sbjct: 135 GISVVQKVSHTLYHLQDIIDRNGGRAPLTYHQFLAII 171 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 521 YTFLLSNVFNVFILLYKLRIYIHLT 447 YT + V L+K RIYI +T Sbjct: 642 YTTTEKELLGVIFALHKFRIYIQVT 666 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 7.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 581 VLSQNFMYIINCMLYSLVNEYTFLLSNVFNVFILLYKL 468 + +NF I ++ S V+ + FLL ++ V I KL Sbjct: 378 ITGKNFFSITRGLILSFVDYFVFLLCSIL-VNIAFIKL 414 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 9.6 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -1 Query: 724 WVYYSLPDCISIGLQWL 674 WV Y P+ + I + W+ Sbjct: 342 WVGYEDPESVQIKMDWI 358 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,831 Number of Sequences: 336 Number of extensions: 3738 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -