BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_K02 (863 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5120| Best HMM Match : Pigment_DH (HMM E-Value=6e-09) 32 0.69 SB_12788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_4933| Best HMM Match : DUF360 (HMM E-Value=0.79) 31 1.2 SB_11029| Best HMM Match : GPS (HMM E-Value=2.2e-07) 31 1.6 SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_29630| Best HMM Match : Sigma54_activat (HMM E-Value=1) 29 3.7 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 29 3.7 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 6.5 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 29 6.5 >SB_5120| Best HMM Match : Pigment_DH (HMM E-Value=6e-09) Length = 820 Score = 31.9 bits (69), Expect = 0.69 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 625 DMVTAVRDNIN-LQIEDHILEVPEFVLGGPVSDVMSHIVVGTDELTTVDE 771 DM+ V D IN ++D +L VP+ V+G + DV+ + G D++ T DE Sbjct: 252 DMLLGVPDVINDAMMDDLLLGVPD-VVGDAMMDVILGVTDGVDDVMTDDE 300 >SB_12788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = +1 Query: 646 DNINLQIEDHILEVPEFVLGGPVSDVMSHIVVGTDELTTVDEYENNIKTDGIPHLTMSPL 825 D +N I +L+V + V+GG + DV ++VG L VD+ + + D + + + + Sbjct: 63 DVVNDVINGLMLDVFDDVIGGLMLDVNDDVIVGL-VLDVVDDVIDGLMLDVLDDVIVGLM 121 Query: 826 TTTQEDTIVV 855 +D IVV Sbjct: 122 VDVVDDVIVV 131 >SB_26878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 449 D*TSHRKPWITPISRS-HYHHWMSRQSVITTKYSSTSPL 562 D T+ RK W +P+ S +HH+ + TT+ TSPL Sbjct: 155 DITTTRKCWTSPLQESVGHHHYQQVLDITTTRKCWTSPL 193 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 449 D*TSHRKPWITPISRS-HYHHWMSRQSVITTKYSSTSPLAE 568 D T+ K W +P+ S +HH+ + TT+ TSPL E Sbjct: 129 DITTTSKCWTSPLPASVGHHHYQQVLDITTTRKCWTSPLQE 169 >SB_4933| Best HMM Match : DUF360 (HMM E-Value=0.79) Length = 443 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = +1 Query: 646 DNINLQIEDHILEVPEFVLGGPVSDVMSHIVVGTDELTTVDEYENNIKTDGIPHLTMSPL 825 D +N I +L+V + V+GG + DV ++VG L VD+ + + D + + + + Sbjct: 137 DVVNDVINGLMLDVFDDVIGGLMLDVNDDVIVGL-VLDVVDDVIDGLMLDVLDDVIVGLM 195 Query: 826 TTTQEDTIVV 855 +D IVV Sbjct: 196 VDVVDDVIVV 205 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/76 (27%), Positives = 38/76 (50%) Frame = +1 Query: 628 MVTAVRDNINLQIEDHILEVPEFVLGGPVSDVMSHIVVGTDELTTVDEYENNIKTDGIPH 807 +V + D +N I +L+V + V+GG + DV ++VG L VD+ + + D + Sbjct: 275 IVVLMFDIVNDVINGLMLDVFDDVIGGLMLDVNDDVIVGL-VLDVVDDVIDGLMLDVVDD 333 Query: 808 LTMSPLTTTQEDTIVV 855 + + +D IVV Sbjct: 334 VMGGLVLDVVDDVIVV 349 >SB_11029| Best HMM Match : GPS (HMM E-Value=2.2e-07) Length = 184 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 589 WRCTGCRLRQR*SRRIFCRNHTLTRHPVMIMAAGDRCD 476 W GCR+ R S + C LT V++ +GDR + Sbjct: 8 WSRDGCRVSSRGSNDVICACDHLTNFAVLVDVSGDRTE 45 >SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +1 Query: 715 SDVMSHIVVGTDELTTVDEYENNIKTDGIPHLTMSPLTTTQEDTIVVK 858 S V++ IV G+ L T+D+ NNIKTD + L + E V+K Sbjct: 188 SSVITSIVTGS--LDTLDDVNNNIKTDFVSTLALQKYQEGMELEDVIK 233 >SB_29630| Best HMM Match : Sigma54_activat (HMM E-Value=1) Length = 1118 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = +1 Query: 319 GEAMGDSVQDTEQLVCWECLAIMRKFLKFKWQVHNAQEHLKVKGLNQSQETLDHTYLPQP 498 G+ +GD + EQ +C + + + HN KVKGL+ + T D L Sbjct: 458 GDYLGDLTSELEQGDFIDCYSSTGP-KSYGYTTHNGHSVCKVKGLHLNIRTADIVNLRTM 516 Query: 499 LSSLDVSSK 525 L LDV + Sbjct: 517 LELLDVEGE 525 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 622 YDMVTAVRDNINLQIEDHILEVPEFVLGGP 711 YD+V +V D + L + D ++ VP+FVL P Sbjct: 947 YDLVMSVPDFV-LSVPDFVMSVPDFVLSVP 975 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 28.7 bits (61), Expect = 6.5 Identities = 26/82 (31%), Positives = 38/82 (46%) Frame = +1 Query: 598 SEDVKSEHYDMVTAVRDNINLQIEDHILEVPEFVLGGPVSDVMSHIVVGTDELTTVDEYE 777 S+DV S D V DN +L +D L + L G V HI + D L T D+ Sbjct: 272 SDDVHSTSGD-VHLKNDNAHLTSDDVHLTSSDVHLTGDVHLKSDHIHLTDDVLLTSDDV- 329 Query: 778 NNIKTDGIPHLTMSPLTTTQED 843 +++ D + HLT + T +D Sbjct: 330 -HLRGDDV-HLTSGDVHLTSDD 349 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 289 IFRLLMFDFAGEAMGDSVQDTEQLVCWECLAIMRKFLKFKWQVHNAQEHLKVKGLNQSQE 468 I+ +D+A E +G+S T++ W CL R W +++ + K +NQS E Sbjct: 550 IYEDCCYDYAFECVGNSTLPTQENEEWSCLD-ERNENGGIWMINSCPQGWKDSAVNQSCE 608 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,163,202 Number of Sequences: 59808 Number of extensions: 552048 Number of successful extensions: 1402 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1389 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -