BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J24 (902 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 5.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.7 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 6.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.7 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 8.8 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 5.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 637 SWPRVVRAGVSESGFGFVASSCVNAVYWRSV 545 +W GV+ G G VAS +A W+S+ Sbjct: 907 TWSNSQVQGVAVPGSGIVASGQQHAGGWQSI 937 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 149 GLASVRNCQHQTPFFDVXQRK 87 G +RN H TPFF +++ Sbjct: 218 GWRKLRNIVHWTPFFQTYKKQ 238 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 149 GLASVRNCQHQTPFFDVXQRK 87 G +RN H TPFF +++ Sbjct: 133 GWRKLRNIVHWTPFFQTYKKQ 153 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 149 GLASVRNCQHQTPFFDVXQRK 87 G +RN H TPFF +++ Sbjct: 452 GWRKLRNIVHWTPFFQTYKKQ 472 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 8.8 Identities = 18/69 (26%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 525 VEEKLRATDRQ*TAFTHELATKPNPLSDTPALTTRGHDTTSRLVLLQRKTN-SINMIDFT 701 + +K++ T L + + P +T GH + LL N SI +F Sbjct: 117 ISKKIKKTMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIAKSEF- 175 Query: 702 GGRTSCESA 728 GG T C A Sbjct: 176 GGITQCIGA 184 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,233 Number of Sequences: 438 Number of extensions: 4532 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -