BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J23 (1221 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 30 0.57 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 25 1.7 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 28 2.3 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 27 5.3 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 30.3 bits (65), Expect = 0.57 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 588 PPPPPPXXFXKKKKXXGGAPPXXKKKXKXXXP 683 PPPPPP F + PP KK K P Sbjct: 10 PPPPPPPGFEPPSQPPPPPPPGYVKKRKNKTP 41 Score = 27.1 bits (57), Expect = 5.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 557 PPPXKXIXXXSSPPPPXPXFXKKK 628 PPP PPPP P + KK+ Sbjct: 13 PPPPGFEPPSQPPPPPPPGYVKKR 36 Score = 26.6 bits (56), Expect = 7.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 557 PPPXKXIXXXSSPPPPXPXFXKKK 628 PPP S PPPP P KK Sbjct: 12 PPPPPGFEPPSQPPPPPPPGYVKK 35 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 25.0 bits (52), Expect(2) = 1.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 567 PKXYXXXPPPPPP 605 P Y PPPPPP Sbjct: 184 PSDYNPPPPPPPP 196 Score = 21.8 bits (44), Expect(2) = 1.7 Identities = 9/35 (25%), Positives = 12/35 (34%) Frame = +3 Query: 588 PPPPPPXXFXKKKKXXGGAPPXXKKKXKXXXPPPP 692 PPPPPP + + P + P P Sbjct: 190 PPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIP 224 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 588 PPPPPPXXFXKKKKXXGGAPPXXKKKXKXXXPPPPXXXXXGGGG 719 PPPPPP + G PP PPPP G Sbjct: 311 PPPPPP-----PSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAG 349 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 722 PPPPPPP 702 PPPPPPP Sbjct: 311 PPPPPPP 317 Score = 21.8 bits (44), Expect(2) = 4.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -2 Query: 719 PPPPPPXXXGGXG 681 PPPPPP G Sbjct: 337 PPPPPPPRSNAAG 349 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 27.1 bits (57), Expect = 5.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 722 PPPPPPPXXXGGXG 681 PPPPPPP G G Sbjct: 761 PPPPPPPPGVAGAG 774 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.148 0.507 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,257,056 Number of Sequences: 5004 Number of extensions: 31056 Number of successful extensions: 165 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 74 effective length of database: 1,992,182 effective search space used: 661404424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -