BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J18 (892 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC737.09c |hmt1|SPCC74.08c|ATP-binding cassette-type vacuolar ... 27 4.7 >SPCC737.09c |hmt1|SPCC74.08c|ATP-binding cassette-type vacuolar membrane transporter Hmt1|Schizosaccharomyces pombe|chr 3|||Manual Length = 830 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 225 ILHHFLESSFGTMISLRTFKFYSKYFHYTYRSIHT 121 +++ FL+ + G + SLR+F + Y YR+I T Sbjct: 309 VIYRFLQGNMGVIGSLRSF-LWVPVSQYAYRAIST 342 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,275,961 Number of Sequences: 5004 Number of extensions: 63849 Number of successful extensions: 131 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -