BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J18 (892 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 25 2.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 4.1 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 25.4 bits (53), Expect = 2.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 708 TYSRLCQPCLKLRSIDISL 652 +Y RLCQ C K +DI L Sbjct: 334 SYDRLCQQCHKALHLDIGL 352 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.6 bits (51), Expect = 4.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 219 HHFLESSFGTMISLRTFKFYSKYFHYTYRSIHTHCT 112 H FL+ T++ LRT+ ++ R HCT Sbjct: 10 HLFLDRPKTTVLHLRTYTSLQSIAFFSTRRSSAHCT 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,754 Number of Sequences: 2352 Number of extensions: 17560 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -