BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J15 (921 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC74.02c |||mRNA cleavage and polyadenylation specificity fact... 27 2.8 SPAC1F3.09 |mug161||CwfJ family protein|Schizosaccharomyces pomb... 27 3.7 SPBC21C3.03 |||ABC1 kinase family protein|Schizosaccharomyces po... 27 4.9 >SPCC74.02c |||mRNA cleavage and polyadenylation specificity factor complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 710 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 135 TNSSVMMISHNLVEIFSNTFTC-RHRCNIKSSNLKDS 28 TNS + ++ NL E+ +FT ++R N KSS DS Sbjct: 312 TNSVIRQLAENLSELAEKSFTIEQNRENEKSSTKNDS 348 >SPAC1F3.09 |mug161||CwfJ family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 27.1 bits (57), Expect = 3.7 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = +2 Query: 20 HYRESLRFEDLMLQRCLHVNVLLKISTKLCEIIMTDEF 133 +Y+ +FE + ++C H + + K+S K C+I+ + E+ Sbjct: 129 YYQPPEKFEQSLNEKCFHRSDVQKLS-KRCDILFSSEW 165 >SPBC21C3.03 |||ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 330 VLKVGESRHVRLDXEFPDAPVTXTLVQGFGVQ-YT*LDTIS 449 V+ + HVR++ F + ++ LV+G G Q Y +D +S Sbjct: 578 VMTMAREHHVRIEANFANTVLSILLVEGAGRQLYPEMDLLS 618 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,690,529 Number of Sequences: 5004 Number of extensions: 39419 Number of successful extensions: 78 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 468512460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -