BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J15 (921 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0406 - 23192363-23194911,23195152-23195247,23195622-23196090 30 3.0 04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807,187... 29 3.9 01_06_0866 - 32572002-32572541,32572806-32572984,32574330-325744... 28 9.1 >11_06_0406 - 23192363-23194911,23195152-23195247,23195622-23196090 Length = 1037 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 62 RCLHVNVLLKISTKLCEIIMTDEFVYC 142 RC HV ++ I+T LCEI + E +C Sbjct: 759 RCSHVILIWHIATSLCEIKLAQEHDHC 785 >04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807, 1876750-1876812 Length = 233 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -3 Query: 412 P*TRVXVTGASGNSMSRRTCLDSPTFNTAXGSFTASCSDMASTCIT 275 P T T A S S + C DSPT +T+ G T + S T Sbjct: 4 PTTSYSTTSAMERSNSTKRCSDSPTVSTSSGRVTTTAWSSTSGAAT 49 >01_06_0866 - 32572002-32572541,32572806-32572984,32574330-32574430, 32574554-32574887,32574915-32575037,32575193-32575394, 32575915-32576097,32576332-32576436,32576553-32576760, 32577025-32577170,32577321-32577443,32577490-32577698, 32577931-32578152,32578189-32578198,32578710-32578763, 32580841-32581052,32581620-32581772,32582071-32582158, 32582192-32582290,32582660-32582907,32584806-32585049 Length = 1260 Score = 28.3 bits (60), Expect = 9.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -3 Query: 400 VXVTGASGNSMSRRTCLDSPTFNTAXGSFTASCSDMASTCITXNSSGLAXGXNNA 236 V + G G + R SP F G+ +C D A+ +T SG+A G A Sbjct: 1140 VRLAGYEGIDLGRPAATVSPEFRVTLGTANGACVDRAA--VTVLYSGVALGWARA 1192 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,232,202 Number of Sequences: 37544 Number of extensions: 277747 Number of successful extensions: 487 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2624101760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -