BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J13 (876 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 25 0.78 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 25 0.78 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 25 0.78 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.1 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 25.0 bits (52), Expect = 0.78 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 199 TYIRHSFLLLLLPPD 155 TYI+H +L L++PP+ Sbjct: 188 TYIQHGYLELVIPPE 202 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 25.0 bits (52), Expect = 0.78 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 199 TYIRHSFLLLLLPPD 155 TYI+H +L L++PP+ Sbjct: 188 TYIQHGYLELVIPPE 202 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 25.0 bits (52), Expect = 0.78 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 199 TYIRHSFLLLLLPPD 155 TYI+H +L L++PP+ Sbjct: 188 TYIQHGYLELVIPPE 202 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -2 Query: 377 IIVVTIPGSYCIICISGILKFHEREWRTFSV 285 I VT+P Y ++ I + + W T V Sbjct: 1007 IYYVTVPSMYLLLVIYSVFNMNNVSWGTREV 1037 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -2 Query: 377 IIVVTIPGSYCIICISGILKFHEREWRTFSV 285 I VT+P Y ++ I + + W T V Sbjct: 1007 IYYVTVPSMYLLLVIYSVFNMNNVSWGTREV 1037 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,678 Number of Sequences: 336 Number of extensions: 2271 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -