BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J12 (928 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0997 + 7884974-7885043,7885689-7885975,7886056-7886311,788... 32 0.56 >01_01_0997 + 7884974-7885043,7885689-7885975,7886056-7886311, 7886455-7886537,7886634-7886687,7887941-7888012, 7889093-7889155,7889274-7889324,7889432-7889513, 7889606-7889701,7889774-7889944,7890024-7890130, 7890229-7890326,7890798-7891048,7891235-7891398, 7891689-7891979,7892067-7892377,7892477-7892655, 7893231-7893301 Length = 918 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 410 TYFIKTNTIIIERFEYGTESVPPRHFKLSL*NTG 309 ++ +K NT++ ER + E PPR +LSL NTG Sbjct: 652 SFKLKENTVVRERAKQVPERTPPRPRRLSLENTG 685 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,367,838 Number of Sequences: 37544 Number of extensions: 239421 Number of successful extensions: 602 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -