BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J03 (920 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07777.1 68415.m00893 expressed protein 30 1.9 At3g28180.1 68416.m03521 glycosyl transferase family 2 protein s... 29 5.7 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 28 7.6 At1g73090.1 68414.m08451 expressed protein 28 7.6 >At2g07777.1 68415.m00893 expressed protein Length = 262 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -3 Query: 297 LSTIVPKFFLTVSGAKADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNACTLA 133 LS+ V FF G+++ S F+L ++ S +FR L R+T C LA Sbjct: 11 LSSSVAGFFGRFLGSESVSRFNLIIFLILLVFSICLFRSLKQYLGKRMTQWCYLA 65 >At3g28180.1 68416.m03521 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 673 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = +2 Query: 164 APKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNL 322 A KE+ +ES + + +L+E+ + + ETVKK+ G ++ N+ N+ Sbjct: 570 AEKEEKLHRRNSESGLELLSKLKEQETNLVGQETVKKSLGGLMRPKNKKKTNM 622 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 851 PPXXXGGXPTXPXXXGGGXXXXXKNXXPPXP 759 PP GG P P GGG PP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 >At1g73090.1 68414.m08451 expressed protein Length = 306 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 250 LGPGDC*EKLWHDGRQLQRI 309 +GPG C + W +GR+LQ++ Sbjct: 272 IGPGVCVGQAWQEGRELQQV 291 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,766,726 Number of Sequences: 28952 Number of extensions: 202301 Number of successful extensions: 535 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2188225800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -