BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_J01 (925 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 29 0.26 DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 26 1.4 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 25 4.3 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 4.3 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 25 4.3 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 25 4.3 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 24 5.7 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 24 5.7 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 24 5.7 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 7.5 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 7.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 7.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.9 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 28.7 bits (61), Expect = 0.26 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 38 RFWSISFPFSCGRVTAWFTVAFLKETYKMAIRPVYRPTIVKKRTKRFI 181 RF++ S C ++ WF VAF E + + P+ R T+ R + + Sbjct: 193 RFFTFSSSLCCF-LSVWFVVAFTVERFIAVLYPLKRQTMCTVRRAKIV 239 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 26.2 bits (55), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 636 YIDEFGQTTTRMQ*KKCFICEIXDAIALFVT 728 ++D GQ T R + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 24.6 bits (51), Expect = 4.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 130 YSHLVCFF*KRDSEPRGDTAARE 62 YSHLV +F + D R AARE Sbjct: 279 YSHLVDYFPEYDGPQRDAIAARE 301 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 24.6 bits (51), Expect = 4.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = -1 Query: 277 VLTLEPPADSVVNTSRFTPIPLKFVIAIRLMP----DKSLRPLFDDCRPVNRSYSH 122 +L +EP A ++ T+ FTP + F+ A L D SL L + + ++Y H Sbjct: 787 ILDVEPQALKILRTAEFTPY-VVFIAAPLLQNIADYDGSLERLAKESDMLRQAYGH 841 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 24.6 bits (51), Expect = 4.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 130 YSHLVCFF*KRDSEPRGDTAARE 62 YSHLV +F + D R AARE Sbjct: 92 YSHLVDYFPEYDGPQRDAIAARE 114 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 24.6 bits (51), Expect = 4.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 130 YSHLVCFF*KRDSEPRGDTAARE 62 YSHLV +F + D R AARE Sbjct: 93 YSHLVDYFPEYDGPQRDAIAARE 115 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 24.2 bits (50), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 130 YSHLVCFF*KRDSEPRGDTAARE 62 YSHLV +F + D D ARE Sbjct: 136 YSHLVDYFPEYDGPKHDDVKARE 158 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 24.2 bits (50), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 130 YSHLVCFF*KRDSEPRGDTAARE 62 YSHLV +F + D D ARE Sbjct: 93 YSHLVDYFPEYDGPKHDDVKARE 115 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 24.2 bits (50), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 130 YSHLVCFF*KRDSEPRGDTAARE 62 YSHLV +F + D D ARE Sbjct: 92 YSHLVDYFPEYDGPKHDDVKARE 114 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 7.5 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +2 Query: 86 WFTVAFLKETYKMAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRN 220 W + AFL + A V + ++R +FI R+D++ N Sbjct: 104 WCSKAFLWAYFIYACETVIVLVVARERINKFISTSDKRFDEVIYN 148 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 7.5 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 716 SNSIXNFTNKAFFSLHS 666 SN+I NFT KAF L S Sbjct: 520 SNNIENFTRKAFKDLPS 536 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.8 bits (49), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 282 CPTLVTVPTRRPVICSQMDSV 344 CP + +P+RR C Q D + Sbjct: 420 CPVRINIPSRRCYRCWQTDHI 440 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 9.9 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 341 GIHLGAYDGSSCWNRNQC-WASS 276 G +LGA ++CWN + W SS Sbjct: 2749 GAYLGAASANNCWNPLKWDWRSS 2771 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,390 Number of Sequences: 2352 Number of extensions: 16114 Number of successful extensions: 28 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100468593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -