BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I23 (895 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-... 27 4.8 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 26 6.3 SPCC1682.11c |||DUF580 family protein|Schizosaccharomyces pombe|... 26 6.3 SPCC895.07 |alp14|mtc1|Mad2-dependent spindle checkpoint compone... 26 6.3 >SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 26.6 bits (56), Expect = 4.8 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 13/87 (14%) Frame = +1 Query: 172 NMPRTKRPVRKQDKTVEDDDTLKKLNKLVLDEKNVIDSR--------TQMEIRNVELAFK 327 +MP K+P+R++ DT +L+K ++ + I S T ++ + E A + Sbjct: 220 DMPIVKKPLRQKTPVSRSSDTTTELSKDLISSSSSIHSTYSSAQTGLTSAKVSSDEYARQ 279 Query: 328 I-----LLGSISNKYLQKTVGELKTEL 393 + L S S +Q+ + LK+EL Sbjct: 280 VDTLDTKLNSSSKSKVQEEISRLKSEL 306 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 172 NMPRTKRPVRKQDKTVEDDDTLKKLNKLVLDEK 270 N P T+ PVR TVE + +NK+ + E+ Sbjct: 940 NKPVTEPPVRASSVTVEPARVTESMNKMNISEE 972 >SPCC1682.11c |||DUF580 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 307 YVFPFVSWSL*RSFHRVQVCSTFSMYHHLQLFCLASVQDVWF 182 +V P SW L SF+ + + +H LQ ++S+ WF Sbjct: 329 WVLPRSSWVL-ASFYSLHFLWLCTFFHALQCAIISSIVSQWF 369 >SPCC895.07 |alp14|mtc1|Mad2-dependent spindle checkpoint component |Schizosaccharomyces pombe|chr 3|||Manual Length = 809 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 250 KLVLDEKNVIDSRTQMEIRNVELAFKILLGSISNKYLQKTVGELKTELH 396 K++ D + I S ++ N EL ++ + N +QK + ELK EL+ Sbjct: 640 KVLEDNDSTISSLESLKRENEELREQLKVEHEENISMQKQLSELKGELN 688 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,081,305 Number of Sequences: 5004 Number of extensions: 38035 Number of successful extensions: 104 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -