BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I22 (873 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.69 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 25 0.91 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 0.91 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 25.4 bits (53), Expect = 0.69 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -3 Query: 418 GGATHRPAHSGGGTPS---RTLARTSSPGA 338 G H P H+ G PS T+A TS+PG+ Sbjct: 209 GYGRHLPGHAQMGRPSYTTATMATTSTPGS 238 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 25.0 bits (52), Expect = 0.91 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -3 Query: 496 ETASSSHRVANVLAVPAASKAHTGPAGGATH--RPA-HSGGGTPSRTLARTSSPGALI 332 ET SS + + P++S + + PA GA +P+ +GG T + L R S +L+ Sbjct: 506 ETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQELKRLKSTVSLL 563 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 25.0 bits (52), Expect = 0.91 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 198 TQLEMLSGKVFVCIVLVTVWIKADCA-SLPFIPTR 299 +QL + SG VFV I++ VW+ D A ++ PTR Sbjct: 767 SQLIICSGLVFVQILINGVWMIIDPAKAMHHYPTR 801 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 249,347 Number of Sequences: 438 Number of extensions: 5781 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28280841 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -