BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I21 (874 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79610.1 68414.m09282 sodium proton exchanger, putative (NHX6... 35 0.082 At3g09000.1 68416.m01053 proline-rich family protein 33 0.25 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 32 0.44 At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidops... 31 0.76 At1g32730.1 68414.m04036 expressed protein 31 0.76 At2g22720.3 68415.m02692 expressed protein 31 1.0 At2g22720.2 68415.m02691 expressed protein 31 1.0 At2g22720.1 68415.m02693 expressed protein 31 1.0 At1g61080.1 68414.m06877 proline-rich family protein 31 1.0 At3g24540.1 68416.m03082 protein kinase family protein contains ... 31 1.3 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 30 1.8 At5g17160.1 68418.m02010 expressed protein 30 1.8 At1g16240.1 68414.m01945 syntaxin 51 (SYP51) identical to SP|Q9S... 30 1.8 At1g65040.2 68414.m07372 zinc finger (C3HC4-type RING finger) fa... 30 2.3 At1g65040.1 68414.m07373 zinc finger (C3HC4-type RING finger) fa... 30 2.3 At4g09150.1 68417.m01515 T-complex protein 11 contains Pfam PF05... 29 3.1 At3g48560.1 68416.m05302 acetolactate synthase, chloroplast / ac... 29 3.1 At1g67020.1 68414.m07620 hypothetical protein 29 3.1 At3g54320.1 68416.m06003 ovule development protein, putative sim... 29 4.1 At3g22520.1 68416.m02846 expressed protein 29 4.1 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 29 5.4 At2g36500.1 68415.m04480 CBS domain-containing protein / octicos... 29 5.4 At1g79590.1 68414.m09280 syntaxin 52 (SYP52) identical to Swiss-... 29 5.4 At5g52020.1 68418.m06455 AP2 domain-containing protein low simil... 28 7.1 At3g53300.1 68416.m05877 cytochrome P450 family protein CYTOCHRO... 28 7.1 At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) fa... 28 7.1 At1g54370.1 68414.m06199 sodium proton exchanger, putative (NHX5... 28 7.1 At1g07490.1 68414.m00802 expressed protein 28 7.1 At5g55400.1 68418.m06902 fimbrin-like protein, putative similar ... 28 9.4 At3g52140.1 68416.m05723 tetratricopeptide repeat (TPR)-containi... 28 9.4 At2g33010.1 68415.m04045 ubiquitin-associated (UBA)/TS-N domain-... 28 9.4 At2g28350.1 68415.m03445 auxin-responsive factor (ARF10) similar... 28 9.4 At1g71310.3 68414.m08231 expressed protein 28 9.4 At1g71310.2 68414.m08230 expressed protein 28 9.4 At1g71310.1 68414.m08229 expressed protein 28 9.4 At1g23540.1 68414.m02960 protein kinase family protein contains ... 28 9.4 At1g20570.1 68414.m02565 tubulin family protein 28 9.4 >At1g79610.1 68414.m09282 sodium proton exchanger, putative (NHX6) identical to Na+/H+ exchanger 6 [Arabidopsis thaliana] gi|19919848|gb|AAM08407 (Plant J. (2002) In press); contains similarity to Na+/H+ antiporter GI:1655701 from [Xenopus laevis]; contains non-consensus AT/AC splice sites; Member of The Monovalent Cation:Proton Antiporter (CPA1) Family, PMID:11500563 Length = 535 Score = 34.7 bits (76), Expect = 0.082 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 252 FVVFLIIFISGRSSALMPLFFIFSALYLFSLIELFVA-MIYSLLAYVDMLIMLM 94 F++ IIF SG S P F F A+ FS++ FVA M+ LL Y+ ++ LM Sbjct: 93 FLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVTGLLVYLGGVMFLM 146 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 33.1 bits (72), Expect = 0.25 Identities = 30/96 (31%), Positives = 40/96 (41%), Gaps = 4/96 (4%) Frame = +3 Query: 357 PVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPK----LTSQRRIAT 524 P SS +P T R + T +TS TS P +S +S +P LT+ R + Sbjct: 147 PSSSGSSRSTSRPATPTRRSTTPTTS--TSR-PVTTRASNSRSSTPTSRATLTAARATTS 203 Query: 525 PSAKRQNNNIQCSKTVGCKLECNTRPGSVSSVKPVN 632 +A R S N RP S SS KPV+ Sbjct: 204 TAAPRTTTTSSGSARSATPTRSNPRPSSASSKKPVS 239 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/70 (27%), Positives = 36/70 (51%) Frame = +3 Query: 321 NARSTKRWKRASPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKL 500 N+RS+ RA+ ++T P T S+ + ++ T P+P+ +S ++ +S Sbjct: 183 NSRSSTPTSRATLTAARATTSTAAPRTTTTSSGSARSATPTRSNPRPSSASSKKPVSRPA 242 Query: 501 TSQRRIATPS 530 T RR +TP+ Sbjct: 243 TPTRRPSTPT 252 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 32.3 bits (70), Expect = 0.44 Identities = 31/115 (26%), Positives = 50/115 (43%) Frame = +3 Query: 354 SPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSA 533 SP P SSS P +L S+ + +S P P SS SLSP L+ ++PS+ Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSS 96 Query: 534 KRQNNNIQCSKTVGCKLECNTRPGSVSSVKPVNVLWFLQPSVMLALIIRKCHVDY 698 +++ S L ++ P S P++ L PS + + ++DY Sbjct: 97 -APPSSLSPSSPPPLSLSPSSPPPPPPSSSPLS---SLSPSSSSSTYSNQTNLDY 147 >At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidopsis thaliana, EMBL:AC007020 Length = 745 Score = 31.5 bits (68), Expect = 0.76 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Frame = +3 Query: 324 ARSTKRWKRASPVPLSSSTIKMKPVTLCRSTRTHS---TSPCTSHAPKPAPSSGQQSLSP 494 A S + + A P+ +S++++ +KP S + S TSP S AP P P++ S P Sbjct: 62 AFSRRAFLLAPPLLVSAASLFLKPSVSLASEESSSATVTSPAESAAPPPPPATTTPSPPP 121 Query: 495 KLTSQRRIAT 524 + + I + Sbjct: 122 PVNKEETITS 131 >At1g32730.1 68414.m04036 expressed protein Length = 327 Score = 31.5 bits (68), Expect = 0.76 Identities = 17/82 (20%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = +3 Query: 393 PVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSAKRQNNNIQCSKTV 572 P C+ + + +PC H K A +SG+++ +P S + AT + + + Sbjct: 43 PFQSCKGCCSRAENPCPIHVLKVASTSGEKTQAPSTPSSEQKATEGTPGSTTRVSSIRQL 102 Query: 573 GCKL-ECNTRPGSVSSVKPVNV 635 + N S KP+ + Sbjct: 103 SSNFAQFNNLNASSRQRKPLTI 124 >At2g22720.3 68415.m02692 expressed protein Length = 569 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = +3 Query: 414 TRTHSTSPCTSHAPKP---APSSGQQSLSPKLTSQRRIATPSAKRQNNNIQCSKTVGCKL 584 ++ + + P TS + P SSG Q S ++ R A+ ++ QN+ Q S+ Sbjct: 240 SKMNHSRPATSGSQMPNSRPASSGSQMQSRAVSGSGRPASSGSQMQNSRPQNSRPASAGS 299 Query: 585 ECNTRPGSVSSVKPVN 632 + RP S S +P + Sbjct: 300 QMQQRPASSGSQRPAS 315 >At2g22720.2 68415.m02691 expressed protein Length = 672 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = +3 Query: 414 TRTHSTSPCTSHAPKP---APSSGQQSLSPKLTSQRRIATPSAKRQNNNIQCSKTVGCKL 584 ++ + + P TS + P SSG Q S ++ R A+ ++ QN+ Q S+ Sbjct: 343 SKMNHSRPATSGSQMPNSRPASSGSQMQSRAVSGSGRPASSGSQMQNSRPQNSRPASAGS 402 Query: 585 ECNTRPGSVSSVKPVN 632 + RP S S +P + Sbjct: 403 QMQQRPASSGSQRPAS 418 >At2g22720.1 68415.m02693 expressed protein Length = 340 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = +3 Query: 414 TRTHSTSPCTSHAPKP---APSSGQQSLSPKLTSQRRIATPSAKRQNNNIQCSKTVGCKL 584 ++ + + P TS + P SSG Q S ++ R A+ ++ QN+ Q S+ Sbjct: 11 SKMNHSRPATSGSQMPNSRPASSGSQMQSRAVSGSGRPASSGSQMQNSRPQNSRPASAGS 70 Query: 585 ECNTRPGSVSSVKPVN 632 + RP S S +P + Sbjct: 71 QMQQRPASSGSQRPAS 86 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +3 Query: 408 RSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSAKRQNNNIQ 557 + +T S+SP S +P P SS LTS RR+++P +N +++ Sbjct: 28 QDVKTSSSSPKPSSSPIPIRSSKSILSGSYLTSSRRVSSPIGNLKNISVK 77 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +3 Query: 357 PVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHA--PKPAPSSGQQSLSPKLTSQRRIATPS 530 P P + + + P RS T ST P + P PA SGQ+ +P +T ++ PS Sbjct: 59 PPPKAPVNVSLSPPPPPRSPST-STPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPS 117 Query: 531 AKRQNNNIQCSKTVG 575 R + ++G Sbjct: 118 PSRLSTGAVVGISIG 132 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 354 SPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSA 533 +P P ++T+ PV T + + A PAP+S S +P +S A+P A Sbjct: 23 APAPSPTTTVTPPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPA 82 >At5g17160.1 68418.m02010 expressed protein Length = 569 Score = 30.3 bits (65), Expect = 1.8 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +3 Query: 372 SSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSAKRQNNN 551 +S K+ P T R+TR +T+ +P PSS S S + TS+ + N N Sbjct: 58 TSVAKLPPSTATRTTRRKTTTKA-----EPQPSSQLVSRSCRSTSKSLAGDMDQENINKN 112 Query: 552 I-QCSKTVGCKLECN 593 + Q KT K E N Sbjct: 113 VAQEMKTSNVKFEAN 127 >At1g16240.1 68414.m01945 syntaxin 51 (SYP51) identical to SP|Q9SA23 Syntaxin 51 (AtSYP51) {Arabidopsis thaliana}; supporting cDNA gi|13811643|gb|AF355755.1|AF355755 Length = 232 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/83 (19%), Positives = 39/83 (46%) Frame = +2 Query: 98 NIINMSTYANNEYIIATNNSINENRYNAEKMKNSGIKALLRPLMKMIKKTTKRVPAKAID 277 N +NMS +AN + ++ + +++ M N GI R +M+ + +++ + Sbjct: 96 NALNMSNFANRDSLLGPDIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEQLEGTVMS 155 Query: 278 TCHEDAQNSSNELLERKIYEEME 346 T H S L+ ++ ++++ Sbjct: 156 TKHIALAVSEELDLQTRLIDDLD 178 >At1g65040.2 68414.m07372 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 281 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 401 GHRFHLDCRRGKRHRTGTLPSLRRSCVPIARCSSS 297 GH FH+ C R R T P+ R VP +S+ Sbjct: 129 GHLFHVHCLRSWLERQNTCPTCRALVVPAENATST 163 >At1g65040.1 68414.m07373 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 389 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 401 GHRFHLDCRRGKRHRTGTLPSLRRSCVPIARCSSS 297 GH FH+ C R R T P+ R VP +S+ Sbjct: 237 GHLFHVHCLRSWLERQNTCPTCRALVVPAENATST 271 >At4g09150.1 68417.m01515 T-complex protein 11 contains Pfam PF05794: T-complex protein 11 Length = 1097 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +3 Query: 426 STSPCTSHAPKPA-PSSGQQSLSPKLTS-QRRIATPS 530 S +P SH P + PS G +LSP L S I+TP+ Sbjct: 556 SKAPADSHLPSSSSPSPGSSNLSPSLNSGSEAISTPN 592 >At3g48560.1 68416.m05302 acetolactate synthase, chloroplast / acetohydroxy-acid synthase (ALS) nearly identical to SP|P17597 Acetolactate synthase, chloroplast precursor (EC 2.2.1.6, formerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS) {Arabidopsis thaliana} Length = 670 Score = 29.5 bits (63), Expect = 3.1 Identities = 24/73 (32%), Positives = 37/73 (50%) Frame = +3 Query: 402 LCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSAKRQNNNIQCSKTVGCK 581 + +T T +TS S + KP+PSS S SP S R + P + N + S+ G K Sbjct: 1 MAAATTTTTTSSSISFSTKPSPSS---SKSPLPIS--RFSLPFSLNPNKSSSSSRRRGIK 55 Query: 582 LECNTRPGSVSSV 620 ++ P S+S+V Sbjct: 56 ---SSSPSSISAV 65 >At1g67020.1 68414.m07620 hypothetical protein Length = 659 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +3 Query: 318 WNARSTKRWKRASPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPK 497 WN+ + R PV + SS + P TL + S CT + SS ++ +P+ Sbjct: 169 WNSFEQRLLARFDPVKIHSSPEVLMPTTLIHVVAHETESRCTEELIEEDESSVRKKSNPE 228 Query: 498 L 500 + Sbjct: 229 I 229 >At3g54320.1 68416.m06003 ovule development protein, putative similar to ovule development protein aintegumenta (GI:1209099) [Arabidopsis thaliana] Length = 427 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +3 Query: 366 LSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSAKRQN 545 L++ST P + S+ T S SP S AP+P + + SP +P++ R++ Sbjct: 5 LTTSTCSSSPSSSVSSSTTTS-SPIQSEAPRPKRAKRAKKSSPSGDKSHNPTSPASTRRS 63 Query: 546 N 548 + Sbjct: 64 S 64 >At3g22520.1 68416.m02846 expressed protein Length = 600 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = +3 Query: 321 NARSTKRWKRASPVPLSSSTIKMKPVTLCRST--------RTHSTSPCTSHAPKPAPSSG 476 N+R ++R ++ P P + ++ KP + R + T +T P +S PKP+ SG Sbjct: 232 NSRYSQRKRKPMPTPQTYEPVEAKPKSTPRGSSNKKKKGATTPATGPQSSTKPKPSRQSG 291 Query: 477 QQS 485 +++ Sbjct: 292 RRT 294 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 354 SPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPS 470 SP P S S + P T +HS + SH+P APS Sbjct: 208 SPSPKSPSPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPS 246 >At2g36500.1 68415.m04480 CBS domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein contains Pfam profiles: PF00571 CBS domain, PF00564: PB1 domain Length = 536 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 299 NSSNELLERKIYEEMEACQSGAAFLVYNQDETCDLVPVNKDTFYV-PVHFART 454 NS+ E E + M+ C++ + + QD+ D V +++D+ V V FAR+ Sbjct: 424 NSTGESFEELMSVVMQRCEADSGLQIMYQDDEGDKVLISRDSDLVAAVTFARS 476 >At1g79590.1 68414.m09280 syntaxin 52 (SYP52) identical to Swiss-Prot:Q94KK7 syntaxin 52 (AtSYP52) [Arabidopsis thaliana] Length = 233 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/81 (18%), Positives = 37/81 (45%) Frame = +2 Query: 104 INMSTYANNEYIIATNNSINENRYNAEKMKNSGIKALLRPLMKMIKKTTKRVPAKAIDTC 283 +NMS +AN + + T+ ++ M N GI R +M+ + +++ + T Sbjct: 99 LNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTK 158 Query: 284 HEDAQNSSNELLERKIYEEME 346 H + L+ ++ ++++ Sbjct: 159 HIALAVNEELTLQTRLIDDLD 179 >At5g52020.1 68418.m06455 AP2 domain-containing protein low similarity to DREB1B GI:3738226 from [Arabidopsis thaliana]; contains Pfam profile PF00847: AP2 domain Length = 232 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 354 SPVPLSSSTIKMKPVTLCRST-RTHSTSPCTSHAPKPAPSSG 476 SP ++ T + V++ T ++ TSP +S +P P PS G Sbjct: 7 SPTTVNQETTTSREVSITLPTDQSPQTSPGSSSSPSPRPSGG 48 >At3g53300.1 68416.m05877 cytochrome P450 family protein CYTOCHROME P450 71B5, Arabidopsis thaliana, SWISSPROT:C7B5_ARATH Length = 498 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 601 GRVLHSSLHPTVLEHWMLLFCR 536 GR+LHSSLH LEH ++ R Sbjct: 45 GRLLHSSLHKLSLEHGPVMLVR 66 >At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 492 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 401 GHRFHLDCRRGKRHRTGTLPSLRRSCVPIARCSSS 297 GH FH+ C R R T P+ R VP +S+ Sbjct: 308 GHLFHVHCLRSWLERQQTCPTCRALVVPPENATSA 342 >At1g54370.1 68414.m06199 sodium proton exchanger, putative (NHX5) contains similarity to Na+/H+ antiporter GI:1655701 from [Xenopus laevis]; Member of The Monovalent Cation:Proton Antiporter (CPA1) Family, PMID:11500563; contains non-consensus AT-AC splice sites at introns 3 and 10 Length = 521 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -2 Query: 252 FVVFLIIFISGRSSALMPLFFIFSALYLFSLIELFVAMI 136 F++ IIF SG S P F F A+ F++I FVA + Sbjct: 92 FLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASV 130 >At1g07490.1 68414.m00802 expressed protein Length = 107 Score = 28.3 bits (60), Expect = 7.1 Identities = 18/73 (24%), Positives = 36/73 (49%) Frame = +3 Query: 336 KRWKRASPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRR 515 ++W+ + L++S + + +R+ STS +S AP SS + P +S Sbjct: 3 EKWRLSKKDALAASCSSSSTSSKSKFSRSFSTSASSSKAPAFVRSSSTKCSVPS-SSSSS 61 Query: 516 IATPSAKRQNNNI 554 I+ S+K++ +I Sbjct: 62 ISRSSSKKEKGSI 74 >At5g55400.1 68418.m06902 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 714 Score = 27.9 bits (59), Expect = 9.4 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 342 WKRASPVPLSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPS-SGQQSLS 491 W S S+ + ST T TS CTS PAPS +G+ +S Sbjct: 620 WSLQQQSSSSESSSSSSDSSSTHSTTTTCTSTCTSTDASPAPSVTGEDEVS 670 >At3g52140.1 68416.m05723 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 1403 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +3 Query: 366 LSSSTIKMKPVTLCRSTRTHSTSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSA 533 ++ + K K +ST T+ST+ S AP P ++ + +P + +AT +A Sbjct: 1 MAGKSNKSKAKRAAQSTTTNSTTDVKSDAPAPPVAATVPATAPVTAAAAPVATAAA 56 >At2g33010.1 68415.m04045 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 649 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 228 ISGRSSALMPLFFIFSALYLFSLIELFVAMIYSLLAYVDMLI 103 I SS + L F FSALYL S + F+ ++++ MLI Sbjct: 259 IMSSSSQVQVLIFSFSALYLSSGLLCFLKIVFTKKGTNSMLI 300 >At2g28350.1 68415.m03445 auxin-responsive factor (ARF10) similar to auxin response factor 10 GI:6165644 from [Arabidopsis thaliana]; identical to cDNA auxin response factor 10 (ARF10) mRNA, partial cds GI:6165643 Length = 693 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 543 NNNIQCSKTVGCKLECNTRPGSVSSVKPVNVLWFLQP 653 +NNI CS T+G + SV SVK + F QP Sbjct: 502 SNNISCSLTMGNPAMVQDKKKSVGSVKTHQFVLFGQP 538 >At1g71310.3 68414.m08231 expressed protein Length = 165 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 170 RYNAEKMKNSGIKALLRPLMKMIKKTTKRVPAKAIDTCHED 292 R++ E + + RPL +++K+ K+VP I T ED Sbjct: 36 RFSTETENDVPTSGISRPLAEILKELNKKVPDSVIRTRVED 76 >At1g71310.2 68414.m08230 expressed protein Length = 176 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 170 RYNAEKMKNSGIKALLRPLMKMIKKTTKRVPAKAIDTCHED 292 R++ E + + RPL +++K+ K+VP I T ED Sbjct: 36 RFSTETENDVPTSGISRPLAEILKELNKKVPDSVIRTRVED 76 >At1g71310.1 68414.m08229 expressed protein Length = 176 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 170 RYNAEKMKNSGIKALLRPLMKMIKKTTKRVPAKAIDTCHED 292 R++ E + + RPL +++K+ K+VP I T ED Sbjct: 36 RFSTETENDVPTSGISRPLAEILKELNKKVPDSVIRTRVED 76 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 429 TSPCTSHAPKPAPSSGQQSLSPKLTSQRRIATPSAKRQNN 548 +SP P P P + +S SP S+ A P+ NN Sbjct: 84 SSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNN 123 >At1g20570.1 68414.m02565 tubulin family protein Length = 976 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = -1 Query: 139 DIFVVSVRRHVDNVNEIVYESVCR**DHRRECQILRIPY 23 + F +++RR VDN++++++ + E +LR Y Sbjct: 626 ECFTINIRRQVDNISKVIFSKLMNEWKLMHELAVLRAIY 664 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,512,284 Number of Sequences: 28952 Number of extensions: 326314 Number of successful extensions: 1410 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1400 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2048424000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -