BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I16 (894 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1350 - 26312275-26313613,26314833-26315110 29 5.0 01_05_0669 - 24152057-24152110,24152224-24152308,24152401-241524... 28 8.7 >08_02_1350 - 26312275-26313613,26314833-26315110 Length = 538 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 146 GYDGLSRTNIPKRNTKMLSYCNSFLNAIKIHQNXXRDSHIV 24 G DG+S + IP R T+ C+S I +N DSH + Sbjct: 281 GGDGMSSSQIPPRLTQHHGSCSSASAKISCGENDSVDSHSI 321 >01_05_0669 - 24152057-24152110,24152224-24152308,24152401-24152486, 24153129-24154341,24154441-24154529,24154607-24154639, 24154674-24154859,24155290-24155380,24155588-24155622, 24155736-24155817,24155968-24156020,24156404-24156469, 24156752-24156820,24156821-24156984,24157925-24158432, 24158543-24158602 Length = 957 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 178 VTHWLRWLFY*RDTCDRRIIYNIVLE 255 + H + W FY TC++ +YN +LE Sbjct: 422 LVHCISWTFYYMLTCNKSPLYNFMLE 447 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,123,049 Number of Sequences: 37544 Number of extensions: 194393 Number of successful extensions: 218 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 217 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -