BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I11 (877 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22PD4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.1 >UniRef50_Q22PD4 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 472 Score = 34.3 bits (75), Expect = 4.1 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 415 SSCQPLQAQATSKNPSTSADMTLSYCQCFTKNCVHLN*NQ 296 + C P A +TS+ TS T+S CQCF N +N NQ Sbjct: 296 AQCSPCPANSTSQ--PTSTINTISSCQCFDPNAAPINTNQ 333 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,222,218 Number of Sequences: 1657284 Number of extensions: 10994938 Number of successful extensions: 24022 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23948 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 78292544701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -