BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I10 (890 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0725 - 20442988-20443180,20443268-20443540,20443642-204438... 30 2.8 >08_02_0725 - 20442988-20443180,20443268-20443540,20443642-20443853, 20443935-20444247,20444334-20444441,20444537-20444643, 20444743-20444781 Length = 414 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 142 YRCICSE--I*FTCSQYG-AGVRERQRYVPTSCLKR*SLCHLSNYEVGSTGFILNGNSLC 312 +RC+ SE + S + +G+R R+ SC+ L L N S F+L+G S C Sbjct: 145 FRCVVSEQMVGIFVSVWARSGLRRHVRHAAASCVGAGVLGRLGNKGAVSVRFLLHGTSFC 204 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,936,984 Number of Sequences: 37544 Number of extensions: 200983 Number of successful extensions: 369 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -