BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I09 (888 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 24 1.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.8 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 24.2 bits (50), Expect = 1.4 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 Query: 488 LQKNQYKDTQALHRQIEGHQE*NSRLQECNRFCFNGQRILTKQRTNYAISFNSIQ 652 ++ + Y+ A RQI HQE Q CN F + +L +Q I+ I+ Sbjct: 142 IEHSDYRAKLAQIRQIY-HQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIE 195 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 540 PSICLCNACVSLYWFFCSVGPLSF 469 P CL C +L F+C G + F Sbjct: 61 PVKCLAFFCTALVIFYCQEGSVDF 84 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 540 PSICLCNACVSLYWFFCSVGPLSF 469 P CL C +L F+C G + F Sbjct: 294 PVKCLAFFCTALVIFYCQEGSVDF 317 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 540 PSICLCNACVSLYWFFCSVGPLSF 469 P CL C +L F+C G + F Sbjct: 294 PVKCLAFFCTALVIFYCQEGSVDF 317 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 9.8 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 581 FCFNGQRILTKQRTNYAISFNSIQLYK-MDTLGDVCTCYKNVTYNVHNICFQ 733 +C G + T RT + N Q + +D + + N TY+ HN+ F+ Sbjct: 534 YCSRGD-LQTYLRTAWDKFTNMQQQFAYIDESSNSSNYFANKTYDFHNMSFE 584 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,484 Number of Sequences: 336 Number of extensions: 3695 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24617054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -