BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I09 (888 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 7.1 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 7.1 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 56 NNAEQAHALFLQVAFGLAVGEEAYQFEHRDLHWGNVLI 169 ++ E L LQ G+ A+QFEH + N + Sbjct: 153 DSTEMPEVLKLQYLLSALKGDAAHQFEHMQITADNYYV 190 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.8 bits (49), Expect = 7.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 138 IAICTGETFSSRPPNKSLPR 197 +A+ TGE + P N S+PR Sbjct: 298 LALPTGENMTQSPSNVSMPR 317 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 767,759 Number of Sequences: 2352 Number of extensions: 16223 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95507181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -