BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I09 (888 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 26 0.40 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 4.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 4.9 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 6.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.5 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 26.2 bits (55), Expect = 0.40 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = -1 Query: 753 LLASIVF*KQILCTL*VTFL*HVQTSPSVSILYNCIELN 637 ++ S + ++C+L T + H++T P+V+ C+ N Sbjct: 155 IMLSFAWIGSVVCSLPQTIVFHLETHPNVTWYSQCVTFN 193 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 4.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 36 LRFATSSTTLNKHTRCSSRWHSVWPW 113 L+ A S +N H + +W+ V+ W Sbjct: 608 LQIALSEFVINPHQQHLDQWNWVYEW 633 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.6 bits (46), Expect = 4.9 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +3 Query: 387 LMKSKLGNDWKNFEPYTNILWLHY 458 ++ K+GN + +PY + W +Y Sbjct: 96 VISEKIGNGGRLLQPYPDWSWANY 119 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 387 LMKSKLGNDWKNFEPYTNILW 449 ++ +K+GN EPY N W Sbjct: 93 VISNKIGNGGPLLEPYPNWSW 113 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = -1 Query: 495 FCSVGPLSFYQQCNVATVCLYMVQSSSNHCPTCFS*G 385 +C +G + VC+ M + H P C S G Sbjct: 86 YCGIGKECELSPNSTIAVCVCMRKCPRRHRPVCASNG 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,581 Number of Sequences: 438 Number of extensions: 4166 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -