BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I06 (905 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 63 4e-12 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 8.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 62.9 bits (146), Expect = 4e-12 Identities = 48/152 (31%), Positives = 70/152 (46%), Gaps = 9/152 (5%) Frame = +3 Query: 216 VKGSYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMG 395 V G V F L+ +L I G++ P+ VQ +P + G D++ A++G G Sbjct: 186 VSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSG 245 Query: 396 KTAVFVLATLQQL-EPSESHVYVLVMCH--------TRELAFQISKEYERFSKYMSGVRV 548 KTA F + + L E S V C TREL QI ++ +FS S ++ Sbjct: 246 KTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFS-LNSILKT 304 Query: 549 SVFFGGMPIQKDEEVLKTACPHIVVGTPGRIL 644 V +GG + L C HI+V TPGR+L Sbjct: 305 VVAYGGTSVMHQRGKLSAGC-HILVATPGRLL 335 Score = 29.1 bits (62), Expect = 0.058 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +1 Query: 697 LDECDKMLESLDMRRDVQEIFRNT--PHG-KQVMMFSATLSKEIRPVCKKFMQD 849 LDE D+ML+ + + + T P G +Q +MFSAT E++ + ++F+ + Sbjct: 353 LDEADRMLDMGFLPSIEKMVDHETMVPLGERQTLMFSATFPDEVQHLARRFLNN 406 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 8.8 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 432 AAAMLPKQTRLSYPYRTWLDKVCPYRG 352 A + P++T + YR W ++ Y G Sbjct: 169 AITIFPQRTDGKHDYRVWNHQLISYAG 195 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,857 Number of Sequences: 438 Number of extensions: 5299 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29388177 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -