BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I04 (856 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 27 0.73 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 2.2 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 27.1 bits (57), Expect = 0.73 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = -2 Query: 291 PSPRTSMGASSSSPNLFD-----SKSVSTAGYPMGLRPA*NGLWAFTNAPR 154 PSP +S+G + PNL +S ST+G P G+ N AF P+ Sbjct: 359 PSPPSSLGMPGNIPNLSQLDATGGQSASTSGLPRGIYTYHNAS-AFQQMPK 408 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 2.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 420 IEINKGKKKTQALKIMRRLQQILQQCLMFEFQY 518 +EI+KG+K L + R L +L L E +Y Sbjct: 916 VEISKGRKTPNELTVRRNLATVLSGNLNEETEY 948 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 779,035 Number of Sequences: 2352 Number of extensions: 15814 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -