BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_I02 (905 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.81 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 7.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 7.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 25.0 bits (52), Expect = 0.81 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 258 AVGRYIFRKKNVVFSF 305 A GR+ F KKN+ +SF Sbjct: 168 ATGRFTFHKKNLYYSF 183 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 7.6 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 903 RQVFKV*XLXELXRLHCCRPIAPSDFFNESTFHLSSNLVKKQIR 772 + VF V EL + + N TFH SSNL +R Sbjct: 95 KNVFGVAYPGELLAILGSSGAGKTTLLNTLTFHTSSNLTVSGLR 138 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 7.6 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 903 RQVFKV*XLXELXRLHCCRPIAPSDFFNESTFHLSSNLVKKQIR 772 + VF V EL + + N TFH SSNL +R Sbjct: 95 KNVFGVAYPGELLAILGSSGAGKTTLLNTLTFHTSSNLTVSGLR 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,187 Number of Sequences: 336 Number of extensions: 4397 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -