BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H19 (912 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23172-13|ABH03527.1| 282|Caenorhabditis elegans Hypothetical p... 28 8.1 U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical p... 28 8.1 >U23172-13|ABH03527.1| 282|Caenorhabditis elegans Hypothetical protein F25B5.7c protein. Length = 282 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 727 GXPPGXGGLXXGRPSVSSLXXPXPRSSXGGXXXSSRGSFQXYECSQRXL 873 G PPG GG+ P P GG S G E QR L Sbjct: 190 GGPPGHGGMGGPPPGQGGPGGPGGPGGPGGMLPKSHGRSNMIEGVQRLL 238 >U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical protein F25B5.7a protein. Length = 562 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 727 GXPPGXGGLXXGRPSVSSLXXPXPRSSXGGXXXSSRGSFQXYECSQRXL 873 G PPG GG+ P P GG S G E QR L Sbjct: 470 GGPPGHGGMGGPPPGQGGPGGPGGPGGPGGMLPKSHGRSNMIEGVQRLL 518 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,229,987 Number of Sequences: 27780 Number of extensions: 232912 Number of successful extensions: 393 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2328783996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -