BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H18 (855 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) 30 2.1 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 >SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) Length = 154 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 234 AKFKLKKPSKRQPARLRYKIEKKVKEHNRKQR 329 AK KKP+ QPA R K +K VK+ K R Sbjct: 118 AKASTKKPTTAQPAAQRQKAQKNVKQMAAKPR 149 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +3 Query: 228 DMAKFKLKKPSKRQPARLRYKIEKKVKEHNRKQR 329 ++AK K K+ KR+ A+ R K +++ +H RKQ+ Sbjct: 202 ELAKHKHKRKRKRESAKHRLKRKRESVKHKRKQK 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,598,619 Number of Sequences: 59808 Number of extensions: 236244 Number of successful extensions: 479 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -