BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H16 (862 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 30 0.49 SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|c... 27 4.5 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 29.9 bits (64), Expect = 0.49 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 340 RVEVTNNYGFINLMGGNGFVNINKRWKGDSVQLLG-TNCRLIVAGKLMSV 486 R+E+ N F+ N + ++ SVQ+ G +NC +I+ GKL +V Sbjct: 397 RIELENTKWFVENQVDNHSIVLDSVELNHSVQIFGCSNCTIIIKGKLNTV 446 >SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 606 Score = 26.6 bits (56), Expect = 4.5 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 372 DETVVIRHLHPTIVANHLDVAVISTNINHAVVSDYFEKTRVRLHC 238 DET + L ++ NH D+ +ST A++S Y ++TRV C Sbjct: 88 DETEDLYRLIKRVLTNHPDLEAVSTG---AILSTY-QRTRVENVC 128 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,187,834 Number of Sequences: 5004 Number of extensions: 64294 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -