BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H16 (862 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 4.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 267 FEKTRVRLHCHFSIVTNNIIAL 202 FE VRL C F TN++I L Sbjct: 276 FEVLLVRLACMFDAQTNSMICL 297 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 4.8 Identities = 14/53 (26%), Positives = 20/53 (37%) Frame = -2 Query: 444 PEELNAVALPTFVDVHKAVSTHKVDETVVIRHLHPTIVANHLDVAVISTNINH 286 P + + P + K V + T + TIV NHL+ TN H Sbjct: 304 PRKSHESQCPMLQKLEKPVLSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSPH 356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,489 Number of Sequences: 438 Number of extensions: 4962 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -