Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_H15
         (898 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    29   0.076
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   8.7  

>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 28.7 bits (61), Expect = 0.076
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +3

Query: 78  TPSFRKSKILDIFLIFVLE--IFSKIKQNEDNLVHIVLL 188
           T S  KSKI  +FLI +L+  + ++I+ NED+   +V L
Sbjct: 345 TESVLKSKIGQVFLITILDSKVSARIEMNEDDNTSLVSL 383


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 410 VPKAMTGMNVPSR 372
           VPK++ G+NV SR
Sbjct: 239 VPKSVAGLNVSSR 251


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 239,944
Number of Sequences: 438
Number of extensions: 5189
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29025360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)