BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H14 (897 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 26 1.4 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 4.1 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 26.2 bits (55), Expect = 1.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 581 RRHASAARNVLPPRRRNCCRPSLEKTKPR 667 R HASA + PR R+ C + T+ R Sbjct: 67 RMHASARKRAYCPRTRSACAETFPSTRRR 95 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 4.1 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 130 CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKP 243 CG K++ +DP E+ +R+M K+ ++ K+P Sbjct: 1179 CGSKQLDIDP---QEVVGGAGACGVRRMAKEKMLRKRP 1213 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 737,092 Number of Sequences: 2352 Number of extensions: 15205 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -