BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H12 (988 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38830.1 68418.m04697 tRNA synthetase class I (C) family prot... 92 5e-19 At2g31170.1 68415.m03805 tRNA synthetase class I (C) family prot... 91 8e-19 At3g56300.1 68416.m06258 tRNA synthetase class I (C) family prot... 85 5e-17 At2g47310.1 68415.m05906 flowering time control protein-related ... 29 6.3 >At5g38830.1 68418.m04697 tRNA synthetase class I (C) family protein similar to SP|Q06752 Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA ligase) (CysRS) {Bacillus subtilis}; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 511 Score = 92.3 bits (219), Expect = 5e-19 Identities = 41/84 (48%), Positives = 58/84 (69%) Frame = +3 Query: 333 ERPVLKLYNSLSRQKEEFIPANGNRVNWYSCGPTVYDASHMGHARSYMSFDILRRVMANY 512 E+ LKLYN++++QKE IP ++ Y CG T YD SH+GHAR+ +SFD+L R + + Sbjct: 4 EKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLYRYL-KH 62 Query: 513 FGYDILYVMNITDIDDKIIKRARQ 584 YD+ +V N TD+DDKII RA + Sbjct: 63 LDYDVTFVRNFTDVDDKIIDRANK 86 >At2g31170.1 68415.m03805 tRNA synthetase class I (C) family protein similar to cysteine-tRNA ligase [Escherichia coli] GI:41203; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 563 Score = 91.5 bits (217), Expect = 8e-19 Identities = 41/80 (51%), Positives = 57/80 (71%) Frame = +3 Query: 345 LKLYNSLSRQKEEFIPANGNRVNWYSCGPTVYDASHMGHARSYMSFDILRRVMANYFGYD 524 L L+N++SR+KE F P +V Y CG T YD SH+GHAR Y++FD+L R + + GY+ Sbjct: 65 LWLHNTMSRKKELFKPKVEGKVGMYVCGVTAYDLSHIGHARVYVTFDVLLRYL-KHLGYE 123 Query: 525 ILYVMNITDIDDKIIKRARQ 584 + YV N TD+DDKII RA++ Sbjct: 124 VSYVRNFTDVDDKIIARAKE 143 >At3g56300.1 68416.m06258 tRNA synthetase class I (C) family protein similar to cysteinyl-tRNA synthetase [Methanococcus maripaludis] GI:6599476; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 489 Score = 85.4 bits (202), Expect = 5e-17 Identities = 37/77 (48%), Positives = 53/77 (68%) Frame = +3 Query: 333 ERPVLKLYNSLSRQKEEFIPANGNRVNWYSCGPTVYDASHMGHARSYMSFDILRRVMANY 512 E+P L LYN++++ KE + P N ++ Y CG T YD SH+GHAR+ +SFD+L R + + Sbjct: 7 EKPDLTLYNTMTQLKEVYKPMNPGKIGIYVCGITAYDYSHIGHARAAVSFDLLYRYL-RH 65 Query: 513 FGYDILYVMNITDIDDK 563 GY + YV N TD+DDK Sbjct: 66 LGYQVTYVRNFTDVDDK 82 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 591 LYEKYLKEPRNLNDTIDDAVNVINYYEEAVKNAEDPDKKIDAEN 722 +YE++LKE L D + + N +EA++N+E + + +N Sbjct: 437 MYERWLKEQTRLQDEKIKSPPLNNESQEAIENSEQVESDVLQQN 480 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,659,710 Number of Sequences: 28952 Number of extensions: 299732 Number of successful extensions: 639 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2402185656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -