BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H11 (901 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 5.0 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 6.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 6.6 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 207 DDIDEDLDTVKGESWKKLLRTLIEAENLCNVFKYYG 314 DD D+D++ G+ + +L + + YYG Sbjct: 399 DDDDDDVEAANGKPAEGMLTDVFHVQETDKYDAYYG 434 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 22.2 bits (45), Expect = 6.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 210 DIDEDLDTVKGESWKKLLRTLIEAENLC 293 DI L + E +KK+ + LI LC Sbjct: 246 DIGPPLHADQAEEYKKIQQILIRMNKLC 273 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 6.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 350 AARAPRSEHRSQTLRGQRAPGKRS 421 A +P+S+ QTLR Q +P + S Sbjct: 399 ATTSPQSQSTIQTLRPQVSPDRTS 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,834 Number of Sequences: 438 Number of extensions: 3348 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -