BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H09 (914 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 111 3e-26 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 26 1.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.6 AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal ... 23 9.8 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 111 bits (267), Expect = 3e-26 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = +3 Query: 549 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 728 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 729 G 731 G Sbjct: 61 G 61 Score = 32.3 bits (70), Expect = 0.021 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 730 GGGTFDVSILTIEDG 774 GGGTFDVSILTI++G Sbjct: 61 GGGTFDVSILTIDEG 75 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 26.2 bits (55), Expect = 1.4 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +2 Query: 665 CDCLRS*QKGYWRTKCTYL*PRAAVPSTCPS---LPSRMVSSR*NPPPAT 805 C+ L + YWR + P +VP PS PS R PPP T Sbjct: 410 CNHLAEYLEAYWRATHPPVRPTPSVPRPLPSQEASPSGEQPGRMGPPPPT 459 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 5.6 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 127 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 228 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal carrier protein A5 protein. Length = 211 Score = 23.4 bits (48), Expect = 9.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 608 IFCGLSLRVIEVRGNRDNCILHSFARDKL 522 + CG L ++ VRG N +F R+++ Sbjct: 9 VACGAVLALVTVRGQAANPTTEAFGRNEI 37 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 971,527 Number of Sequences: 2352 Number of extensions: 21678 Number of successful extensions: 85 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99228240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -