BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_H08 (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 3.6 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.8 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 3.6 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +3 Query: 147 VNHEGIPIKSSLDNATSVLYAGLIGQ 224 + H+G PI+ + T ++ AG++G+ Sbjct: 574 LTHKGKPIRMRIGIHTGMVLAGVVGK 599 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.8 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -3 Query: 313 ISCLRLLTRRNVNSFVESISRTTFLAFSVSCPISPAYNTEVALSN 179 I+C T N N+F+ T + F I + NT LS+ Sbjct: 321 IACWDTNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTMYVLSD 365 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,129 Number of Sequences: 438 Number of extensions: 5162 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -