BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G22 (885 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.54 SB_55417| Best HMM Match : Kelch_2 (HMM E-Value=4.8e-23) 32 0.54 SB_32544| Best HMM Match : Extensin_2 (HMM E-Value=0.0062) 32 0.71 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 0.86 SB_55144| Best HMM Match : CMAS (HMM E-Value=0.72) 31 1.6 SB_16232| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_52818| Best HMM Match : CUB (HMM E-Value=1.6e-23) 30 2.2 SB_46466| Best HMM Match : Neur_chan_memb (HMM E-Value=4.8) 30 2.2 SB_56101| Best HMM Match : efhand (HMM E-Value=0.029) 30 2.9 SB_20795| Best HMM Match : Amelogenin (HMM E-Value=1) 30 2.9 SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) 30 2.9 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 29 3.8 SB_6609| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_4516| Best HMM Match : rve (HMM E-Value=6.5) 29 5.0 SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14) 29 6.6 SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) 29 6.6 SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_18792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_10801| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_4506| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_59489| Best HMM Match : RnaseH (HMM E-Value=0.0047) 29 6.6 SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) 29 6.6 SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) 29 6.6 SB_54350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_51440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_17759| Best HMM Match : adh_short (HMM E-Value=1.5) 29 6.6 SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) 29 6.6 SB_14196| Best HMM Match : FG-GAP (HMM E-Value=0) 29 6.6 SB_4690| Best HMM Match : rve (HMM E-Value=1.5) 29 6.6 SB_4584| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_49695| Best HMM Match : Homeobox (HMM E-Value=0.068) 28 8.7 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = -1 Query: 564 HCIADTDTAPSKQPALNGTPSPISARTKPPSVSLSTATSS--IEDDMSIP-IHICPFSSS 394 H ++ PS P+ + +P+P S + PS + S+ SS + +S P I P S+ Sbjct: 482 HPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSPNPISNPSISTSPISNP 541 Query: 393 TVPDNPEPHPISNNKHDESSGNRSN 319 NP PHP SN + S SN Sbjct: 542 HPSSNPSPHPSSNPSSEPSPNPSSN 566 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 4/80 (5%) Frame = -1 Query: 549 TDTAPSKQPALNGTPSPISARTKPPSVSLSTATSS--IEDDMSIP-IHICPFSSSTVPDN 379 T + P+ N +P P S + PS + S+ SS + S P + P SSS+ Sbjct: 535 TSPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDPSLSFSPSSSSSPSVR 594 Query: 378 PEPHPISN-NKHDESSGNRS 322 P P+ ISN N++ S+ NR+ Sbjct: 595 PSPNLISNPNRNSNSNSNRN 614 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -1 Query: 489 RTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEPHPISNNKHDESSGNRSN 319 +T P + S +TS I + P H P SS NP P+P S+ + SS S+ Sbjct: 455 KTSNPISNPSISTSPISNPSPRP-HPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSD 510 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = -1 Query: 555 ADTDTAPSKQPALNGTPSPISARTKPPSVSL-STATSSIEDDMSIPIHICPFSSSTVPDN 379 +D PS P+L+ +PS S+ + PS +L S + + + + S ++ N Sbjct: 569 SDPSPNPSSDPSLSFSPSSSSSPSVRPSPNLISNPNRNSNSNSNRNPNPSSNPSPSLSPN 628 Query: 378 PEPHPISNNKHDESSGNRSN 319 P P+P ++ + SS N Sbjct: 629 PSPNPSTSPYRNHSSNTNPN 648 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = -1 Query: 543 TAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEPHP 364 +AP ++ N ART+P T TS++ + P+ P P HP Sbjct: 306 SAPRRENLYNENNQHGHARTQPQVYREPTRTSTVAHSIPAPVASVPQPPPQPAQQPASHP 365 Query: 363 ISNNKHDES 337 ++++ DE+ Sbjct: 366 SASSRQDEA 374 >SB_55417| Best HMM Match : Kelch_2 (HMM E-Value=4.8e-23) Length = 1153 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -1 Query: 549 TDTAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSI-PIHICPFSSS 394 T A KQP G+P+P+ + PPS + S A S ++ P H P SS+ Sbjct: 314 TPQASMKQPIAAGSPTPLKGSSIPPSPNRSPAASPAPSPSAVKPFH--PVSSA 364 >SB_32544| Best HMM Match : Extensin_2 (HMM E-Value=0.0062) Length = 282 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -1 Query: 543 TAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEP 370 T P K AL +P P PP S + +S S+ + PF S+ +P +P P Sbjct: 23 TPPFKSAALPSSPQPSLQVQSPPFKSAALPSSP---QPSLQVRTPPFKSAALPSSPHP 77 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -1 Query: 543 TAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEP 370 T P K L +P P PP S + +S S+ +H PF S+ P +P+P Sbjct: 83 TPPFKSAPLPLSPQPSLQVRSPPFKSAAFPSSP---QPSLQVHSPPFKSAAFPSSPQP 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -1 Query: 537 PSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEP 370 P K A +P P S + + P + SS + S+ +H PF S+ +P +P P Sbjct: 205 PFKSAAFPSSPQP-SLQVRTPLFKSAALPSSPQP--SLQVHTPPFKSTPLPSSPHP 257 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -1 Query: 537 PSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEP 370 P K AL +P P PP S + +S S+ + PF S+ +P +P+P Sbjct: 45 PFKSAALPSSPQPSLQVRTPPFKSAALPSSP---HPSLQVRTPPFKSAPLPLSPQP 97 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 25.4 bits (53), Expect(2) = 0.86 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 408 PFSSSTVPDNPEPHPISNNKHDESSGNR 325 PF + P PEP P+S K G R Sbjct: 1305 PFDDTPTPSRPEPGPLSVVKAISRRGKR 1332 Score = 24.6 bits (51), Expect(2) = 0.86 Identities = 11/51 (21%), Positives = 28/51 (54%) Frame = -1 Query: 573 LNNHCIADTDTAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIP 421 + +H + T AP+ PA + + +P + +S+++++ + +MS+P Sbjct: 1227 ITSHGTSSTP-APNSTPAKRTRGRGVKVKDEPETPVISSSSATSQTEMSLP 1276 >SB_55144| Best HMM Match : CMAS (HMM E-Value=0.72) Length = 529 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/75 (28%), Positives = 36/75 (48%) Frame = +2 Query: 362 IGCGSGLSGTVLEENGHMWIGMDISSSMLDVAVERDTEGGLVLADMGEGVPFRAGCFDGA 541 IGCG+G ++ + G D +++A ER E + L D +P+R C D Sbjct: 56 IGCGTGKYLSISTDA--FITGSDCCPKFVEIARERQHE--VSLCD-NLSLPYRDDCLDAV 110 Query: 542 VSVSAIQWLFNADKK 586 +SV I L ++ ++ Sbjct: 111 ISVGVIHHLASSKRR 125 >SB_16232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSVSLSTATSSIED 436 +LNN D D P +PA NG P RT P + L+ I++ Sbjct: 208 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGIMLNHVERDIKE 253 >SB_52818| Best HMM Match : CUB (HMM E-Value=1.6e-23) Length = 898 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 498 ISARTKPPSVSLSTATSSIEDDMSI-PIHICPFSSSTVPDNPEPHPISNNKHDE 340 + TKPP + T T +D+ S+ PI+ P++ + P P SN+ HD+ Sbjct: 329 VGKSTKPPPATPRTTT---KDEASMRPIYSVPYTGKSHALTPTPTENSNSSHDK 379 >SB_46466| Best HMM Match : Neur_chan_memb (HMM E-Value=4.8) Length = 498 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = -1 Query: 519 LNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSST 391 ++G +PIS S+S STA+SS +P + PFSSST Sbjct: 132 ISGEGTPISMSNHSASLSSSTASSSSFPPCGVPSN-TPFSSST 173 >SB_56101| Best HMM Match : efhand (HMM E-Value=0.029) Length = 361 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = -1 Query: 552 DTDTAPSKQPALNGTP----SPISARTKPPSVSLSTATSSI 442 D DTA S + +NG+P S +S+RTK +VSL A SI Sbjct: 8 DGDTATSSKEKVNGSPFEEESVLSSRTKVLTVSLLVALLSI 48 >SB_20795| Best HMM Match : Amelogenin (HMM E-Value=1) Length = 630 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/59 (25%), Positives = 29/59 (49%) Frame = -1 Query: 489 RTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEPHPISNNKHDESSGNRSNSK 313 RT+PP+V+ T T+ + S + +S + NP P+ + K + G S+++ Sbjct: 73 RTEPPTVTSGTNTNMTKSPFSSLSNALSTIASIITSNPFTKPMPSYKSNRHDGTNSSTE 131 >SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 824 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/42 (26%), Positives = 24/42 (57%) Frame = -1 Query: 429 SIPIHICPFSSSTVPDNPEPHPISNNKHDESSGNRSNSKHLS 304 S+P + + + P+ P P P S++KH++ + ++ +H S Sbjct: 457 SLPAQLNYEIAGSSPNKPTPKPQSDSKHEQGTPDKKKKRHRS 498 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 29.5 bits (63), Expect = 3.8 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 3/79 (3%) Frame = -1 Query: 501 PISARTKP-PSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEPHPISNNKHDESSGNR 325 P RT+ PSV+ T+T S + S+P P T +P PI ++H ++ R Sbjct: 1044 PSRGRTRSNPSVTTETSTLSKQKRPSLPCRAYPV---TREPSPIRKPIQPSEHAQTVPRR 1100 Query: 324 SNS--KHLSVICXLDFYDP 274 NS ++C + +P Sbjct: 1101 KNSAGNTYGLVCQISAVEP 1119 >SB_6609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -1 Query: 402 SSSTVPDN--PEPHPISNNKHDESSGNRSNSKH 310 S+S++ +N P H +KHD+ S N+ SKH Sbjct: 118 STSSLANNTIPSKHDKRTSKHDDGSNNKRTSKH 150 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = -1 Query: 540 APSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNP 376 +PS+ P+LN P+P S+ T PPS S T+S S + P SS V P Sbjct: 958 SPSEAPSLN-NPNPRSSCTTPPS---SDTTNSSSAGPSATNNASPSSSPYVASAP 1008 >SB_4516| Best HMM Match : rve (HMM E-Value=6.5) Length = 262 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 200 SLNNTSATD-DYEPVSEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 243 >SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14) Length = 691 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 629 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 672 >SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) Length = 1020 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = -1 Query: 549 TDTAPSKQPALNGTPSPI-SARTKPPSVSLSTATSSIEDDMSI-PIHICPFSSSTVPDNP 376 T T PS + T P+ S T+ + S +T+ I+ S PI P ++ST P P Sbjct: 310 TATKPSTFQPQSSTRHPLTSITTRTTPIKPSPSTTPIKPSPSTTPIKPSPSTTSTTPIKP 369 Query: 375 EPH 367 P+ Sbjct: 370 SPN 372 >SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 303 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 346 >SB_18792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 793 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 731 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 774 >SB_10801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 910 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 437 MICPSQSTYVHFLLALYQIILNHIQYPTTSMMNLPVIEVILSI 309 M+C T V ++AL I NH +P + +P+I ++L++ Sbjct: 500 MLCVYGVTAVAAVIALGAIPQNHASFPYMVPLAVPIISILLNV 542 >SB_4506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 22 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 65 >SB_59489| Best HMM Match : RnaseH (HMM E-Value=0.0047) Length = 567 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 505 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 548 >SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) Length = 679 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 272 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 315 >SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) Length = 1238 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 1176 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 1219 >SB_54350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 862 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 905 >SB_51440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 37 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 80 >SB_17759| Best HMM Match : adh_short (HMM E-Value=1.5) Length = 779 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/58 (27%), Positives = 23/58 (39%) Frame = +2 Query: 563 WLFNADKKTHNPVKRLNKFFTTLYSSLSRSARAVFQFYPENEKQLELLTTQAMKAGFY 736 W+ + + N V+R+ + T S S S A Q Y E +E L A Y Sbjct: 403 WIASGIARDLNDVRRIQQLLVTKLSKFSTSKEAALQLYNEAATTMEKLAVLKAWAEVY 460 >SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) Length = 921 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 859 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 902 >SB_14196| Best HMM Match : FG-GAP (HMM E-Value=0) Length = 693 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -1 Query: 387 PDNPEPHPISNNKHDESSGNRSNSKHLS 304 P+ P P P S++KH++ + ++ +H S Sbjct: 4 PNKPTPKPQSDSKHEQGTPDKKKKRHRS 31 >SB_4690| Best HMM Match : rve (HMM E-Value=1.5) Length = 282 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 220 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 263 >SB_4584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 576 ALNNHCIADTDTAPSKQPALNGTPSPISARTKPPSV-SLSTATSS 445 +LNN D D P +PA NG P RT P + ST T S Sbjct: 53 SLNNTSATD-DYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQS 96 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/59 (25%), Positives = 23/59 (38%) Frame = -1 Query: 543 TAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMSIPIHICPFSSSTVPDNPEPH 367 TAP++ TP+P + K P+ + ST T P P + + P H Sbjct: 62 TAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAH 120 >SB_49695| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 919 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = -1 Query: 555 ADTDTAPSKQPALNGTPSPISARTKPPSVSLSTATSSIEDDMS 427 A+ TAP + L P P S +++ P+V S+ SS E+++S Sbjct: 135 AEQPTAPEESELLE-PPCPPSTQSEEPAVGTSSQCSSPEEEIS 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,913,788 Number of Sequences: 59808 Number of extensions: 500240 Number of successful extensions: 1578 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1565 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -